F263951

General Info

Members Datasets Scaffolds Average Seq Length
174 129 173 221

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100046525|Ga0070689_1000465252
Length 233
Sequence MEPLELPVKILGVDLETFAAVDRFIGETIVGEDEALRGAVEVAEAAGLPSIQVSPPQGKLLQLLVRLLGARKILEFGTLGGYSSILMARALPEDGRLITLEAKAEYAEVARRSIERAGVADKVEVRVGPALEALPGLEEAGPFDLVFIDADKVNTPNYFAWALDHTRPGGLIVADNVVRGGTLGDATDPDEATKAQRRLHETLAGEGLVSATTIQTVGGKGYDGFLLALVQDA

Samples

Sample ID Description Type Environment
1 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
72 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
73 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
74 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
75 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
98 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
110 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
125 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
126 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
127 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 14.37
Rhizosphere 83.91
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1002420 3300000546 Bacteria 2248
2 JGI24740J21852_10002914 3300001979 Bacteria 7630
3 JGI25404J52841_10025407 3300003659 Bacteria 1276
4 Ga0070683_100007065 3300005329 Bacteria 9454
5 Ga0070666_10011954 3300005335 Bacteria 5463
6 Ga0070682_100000032 3300005337 Bacteria 155141
7 Ga0070689_100046525 3300005340 Bacteria 3344
8 Ga0070691_10000003 3300005341 Bacteria 86538
9 Ga0070661_100000236 3300005344 Bacteria 45535
10 Ga0070668_100012523 3300005347 Bacteria 6316
11 Ga0070668_100864517 3300005347 Bacteria 806
12 Ga0070675_100003153 3300005354 Bacteria 12477
13 Ga0070671_100170092 3300005355 Bacteria 1843
14 Ga0070688_100063310 3300005365 Bacteria 2343
15 Ga0070659_100010350 3300005366 Bacteria 6859
16 Ga0070667_100001611 3300005367 Bacteria 20202
17 Ga0070667_100090916 3300005367 Bacteria 2624
18 Ga0070714_100036840 3300005435 Bacteria 4106
19 Ga0070713_100000171 3300005436 Bacteria 43503
20 Ga0070710_10036170 3300005437 Bacteria 2698
21 Ga0070678_100107182 3300005456 Bacteria 2179
22 Ga0070685_10082670 3300005466 Bacteria 1928
23 Ga0070684_100065586 3300005535 Bacteria 3187
24 Ga0070684_100248531 3300005535 Bacteria 1625
25 Ga0068853_100341918 3300005539 Bacteria 1390
26 Ga0070665_100033969 3300005548 Bacteria 5130
27 Ga0070665_100051471 3300005548 Bacteria 4130
28 Ga0070664_100085966 3300005564 Bacteria 2717
29 Ga0068857_100120727 3300005577 Bacteria 2359
30 Ga0068854_100000939 3300005578 Bacteria 17543
31 Ga0068856_100007857 3300005614 Bacteria 10417
32 Ga0070702_100156084 3300005615 Bacteria 1470
33 Ga0068852_100249229 3300005616 Bacteria 1701
34 Ga0068851_10000247 3300005834 Bacteria 25479
35 Ga0068851_10010277 3300005834 Bacteria 4365
36 Ga0068863_100008951 3300005841 Bacteria 9775
37 Ga0068863_100128271 3300005841 Bacteria 2420
38 Ga0068858_100347795 3300005842 Bacteria 1420
39 Ga0068860_100335646 3300005843 Bacteria 1485
40 Ga0068862_100001247 3300005844 Bacteria 23931
41 Ga0081455_10030975 3300005937 Bacteria 4848
42 Ga0081540_1000435 3300005983 Bacteria 41191
43 Ga0105247_10101811 3300009101 Bacteria 1837
44 Ga0105243_10006175 3300009148 Bacteria 9263
45 Ga0105242_10000123 3300009176 Bacteria 56900
46 Ga0105242_10000589 3300009176 Bacteria 28679
47 Ga0105249_10000944 3300009553 Bacteria 25723
48 Ga0157370_10031292 3300013104 Bacteria 5207
49 Ga0157370_10339829 3300013104 Bacteria 1384
50 Ga0157378_10023974 3300013297 Bacteria 5367
51 Ga0157372_10000809 3300013307 Bacteria 33940
52 Ga0157375_10016258 3300013308 Bacteria 6675
53 Ga0157375_10758890 3300013308 Bacteria 1121
54 Ga0157380_10000326 3300014326 Bacteria 28781
55 Ga0157380_10201317 3300014326 Bacteria 1767
56 Ga0157380_10937039 3300014326 Bacteria 895
57 Ga0157379_10061736 3300014968 Bacteria 3352
58 Ga0157379_10125618 3300014968 Bacteria 2308
59 Ga0157376_10028749 3300014969 Bacteria 4422
60 Ga0207656_10000374 3300025321 Bacteria 15006
61 Ga0207656_10013950 3300025321 Bacteria 3084
62 Ga0207692_10079159 3300025898 Bacteria 1753
63 Ga0207710_10279714 3300025900 Bacteria 840
64 Ga0207680_10005958 3300025903 Bacteria 5858
65 Ga0207649_10000166 3300025920 Bacteria 53758
66 Ga0207659_10000138 3300025926 Bacteria 42755
67 Ga0207700_10000019 3300025928 Bacteria 183117
68 Ga0207664_10013567 3300025929 Bacteria 5855
69 Ga0207644_10124256 3300025931 Bacteria 1968
70 Ga0207690_10003914 3300025932 Bacteria 8802
71 Ga0207686_10026039 3300025934 Bacteria 3410
72 Ga0207709_10002223 3300025935 Bacteria 12376
73 Ga0207661_10000616 3300025944 Bacteria 22858
74 Ga0207661_10369223 3300025944 Bacteria 1297
75 Ga0207679_10189407 3300025945 Bacteria 1709
76 Ga0207640_10000821 3300025981 Bacteria 17670
77 Ga0207658_10000840 3300025986 Bacteria 25652
78 Ga0207658_10093359 3300025986 Bacteria 2339
79 Ga0207702_10002042 3300026078 Bacteria 19546
80 Ga0207641_10015727 3300026088 Bacteria 6200
81 Ga0207641_10045909 3300026088 Bacteria 3681
82 Ga0207683_10111504 3300026121 Bacteria 2450
83 Ga0207698_10259023 3300026142 Bacteria 1597
84 Ga0268266_10018264 3300028379 Bacteria 5979
85 Ga0268266_10055970 3300028379 Bacteria 3392
86 Ga0268265_10000667 3300028380 Bacteria 34047
87 Ga0265337_1000032 3300028556 Bacteria 61342
88 Ga0265326_10000040 3300028558 Bacteria 85624
89 Ga0265322_10000012 3300028654 Bacteria 152373
90 Ga0265336_10001404 3300028666 Bacteria 11115
91 Ga0265324_10000202 3300029957 Bacteria 45480
92 Ga0265320_10000001 3300031240 Bacteria 847191
93 Ga0265329_10039576 3300031242 Bacteria 1514
94 Ga0265331_10001467 3300031250 Bacteria 17360
95 Ga0265327_10000003 3300031251 Bacteria 852750
96 Ga0265316_10022318 3300031344 Bacteria 5339
97 Ga0265314_10000178 3300031711 Bacteria 94070
98 Ga0451802_1687494 3300041460 Bacteria 1506
99 Ga0451853_2894472 3300041512 Bacteria 5773
100 Ga0466958_0007909 3300045836 Bacteria 5877
101 Ga0466958_0093805 3300045836 Bacteria 1859
102 Ga0466967_0000003 3300045976 Bacteria 169144
103 Ga0495629_0006510 3300046459 Bacteria 8654
104 Ga0495582_0002254 3300046473 Bacteria 10787
105 Ga0495594_0000001 3300046499 Bacteria 293051
106 Ga0495606_0000283 3300046507 Bacteria 88309
107 Ga0495608_0000010 3300046511 Bacteria 258660
108 Ga0495610_0010836 3300046512 Bacteria 5628
109 Ga0495620_0057580 3300046515 Bacteria 1630
110 Ga0495628_0000864 3300046516 Bacteria 28036
111 Ga0495630_0427742 3300046517 Bacteria 1014
112 Ga0495652_0000009 3300046529 Bacteria 311000
113 Ga0495640_0037352 3300046533 Bacteria 3426
114 Ga0495587_0029873 3300046536 Bacteria 3307
115 Ga0495587_0054173 3300046536 Bacteria 2364
116 Ga0495588_0000175 3300046674 Bacteria 80911
117 Ga0495657_0000005 3300046675 Bacteria 254860
118 Ga0495658_0001854 3300046683 Bacteria 10794
119 Ga0495669_0031979 3300046684 Bacteria 2311
120 Ga0495613_0000087 3300046689 Bacteria 88644
121 Ga0495624_0000429 3300046690 Bacteria 33305
122 Ga0495600_0005362 3300046809 Bacteria 7731
123 Ga0495604_0000322 3300047317 Bacteria 42966
124 Ga0495604_0000928 3300047317 Bacteria 24396
125 Ga0495674_0000141 3300047319 Bacteria 55539
126 Ga0495672_0024804 3300047320 Bacteria 3855
127 Ga0495672_0056693 3300047320 Bacteria 2278
128 Ga0495672_0183110 3300047320 Bacteria 1059
129 Ga0495676_0034901 3300047321 Bacteria 4214
130 Ga0495675_0024971 3300047444 Bacteria 3811
131 Ga0495675_0129871 3300047444 Bacteria 1566
132 Ga0495593_0056805 3300047673 Bacteria 2057
133 Ga0495602_0000038 3300048088 Bacteria 130758
134 Ga0495602_0003702 3300048088 Bacteria 15861
135 Ga0495602_0037972 3300048088 Bacteria 4460
136 Ga0496102_0316541 3300048905 Bacteria 1470
137 Ga0496104_0000029 3300048907 Bacteria 202968
138 Ga0496104_0004081 3300048907 Bacteria 12671
139 Ga0496104_0659837 3300048907 Bacteria 955
140 Ga0496105_0000002 3300048908 Bacteria 753215
141 Ga0496105_0000070 3300048908 Bacteria 80117
142 Ga0496108_0000042 3300048911 Bacteria 146397
143 Ga0496108_0002451 3300048911 Bacteria 14838
144 Ga0496108_0240591 3300048911 Bacteria 1574
145 Ga0496109_0000034 3300048912 Bacteria 160397
146 Ga0496109_0000062 3300048912 Bacteria 112843
147 Ga0496109_0087121 3300048912 Bacteria 2884
148 Ga0496110_0000325 3300048913 Bacteria 31707
149 Ga0496110_0017193 3300048913 Bacteria 6047
150 Ga0496110_0623524 3300048913 Bacteria 977
151 Ga0496111_0000171 3300048914 Bacteria 29367
152 Ga0496111_0036271 3300048914 Bacteria 3525
153 Ga0496111_0226331 3300048914 Bacteria 1389
154 Ga0496112_0100635 3300048915 Bacteria 2860
155 Ga0496112_0536486 3300048915 Bacteria 1104
156 Ga0496113_0000002 3300048916 Bacteria 220193
157 Ga0496113_0029367 3300048916 Bacteria 3969
158 Ga0496113_0087777 3300048916 Bacteria 2392
159 Ga0496114_0062679 3300048917 Bacteria 3112
160 Ga0496119_0014960 3300048922 Bacteria 6023
161 Ga0501070_0064865 3300049586 Bacteria 3024
162 Ga0495601_0000698 3300053077 Bacteria 18035
163 Ga0495601_0131084 3300053077 Bacteria 1633
164 Ga0495601_0324028 3300053077 Bacteria 1003
165 Ga0495612_0001451 3300053078 Bacteria 9769
166 Ga0495612_0004945 3300053078 Bacteria 5516
167 Ga0495655_0000120 3300053083 Bacteria 14477
168 Ga0495595_0000005 3300053084 Bacteria 258660
169 Ga0495595_0006235 3300053084 Bacteria 4854
170 Ga0495619_0000069 3300053085 Bacteria 82755
171 Ga0495619_0024714 3300053085 Bacteria 3854
172 Ga0495619_0026792 3300053085 Bacteria 3711
173 Ga0500566_0013929 3300053094 Bacteria 4727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005366 Ga0070659_100010350 Ga0070659_1000103502 188
2 3300025932 Ga0207690_10003914 Ga0207690_100039146 188
3 3300005367 Ga0070667_100001611 Ga0070667_1000016115 190
4 3300005842 Ga0068858_100347795 Ga0068858_1003477952 190
5 3300005844 Ga0068862_100001247 Ga0068862_1000012475 190
6 3300009553 Ga0105249_10000944 Ga0105249_100009442 190
7 3300014968 Ga0157379_10061736 Ga0157379_100617362 190
8 3300025986 Ga0207658_10000840 Ga0207658_1000084033 190
9 3300028380 Ga0268265_10000667 Ga0268265_1000066724 190
10 3300005347 Ga0070668_100012523 Ga0070668_1000125231 191
11 3300048913 Ga0496110_0017193 Ga0496110_0017193_1452_2117 208
12 3300048913 Ga0496110_0623524 Ga0496110_0623524_255_926 208
13 3300048914 Ga0496111_0226331 Ga0496111_0226331_660_1325 208
14 3300005615 Ga0070702_100156084 Ga0070702_1001560842 210
15 3300005834 Ga0068851_10010277 Ga0068851_100102775 210
16 3300025321 Ga0207656_10013950 Ga0207656_100139502 210
17 3300001979 JGI24740J21852_10002914 JGI24740J21852_100029142 214
18 3300053078 Ga0495612_0004945 Ga0495612_0004945_2291_2962 214
19 3300003659 JGI25404J52841_10025407 JGI25404J52841_100254072 217
20 3300005983 Ga0081540_1000435 Ga0081540_100043543 217
21 3300014326 Ga0157380_10937039 Ga0157380_109370391 217
22 3300046674 Ga0495588_0000175 Ga0495588_0000175_49759_50430 217
23 3300053077 Ga0495601_0324028 Ga0495601_0324028_111_824 217
24 3300013297 Ga0157378_10023974 Ga0157378_100239744 219
25 3300046459 Ga0495629_0006510 Ga0495629_0006510_1087_1746 219
26 3300053094 Ga0500566_0013929 Ga0500566_0013929_1525_2184 219
27 3300005335 Ga0070666_10011954 Ga0070666_100119543 220
28 3300005344 Ga0070661_100000236 Ga0070661_10000023616 220
29 3300005354 Ga0070675_100003153 Ga0070675_10000315313 220
30 3300005436 Ga0070713_100000171 Ga0070713_10000017133 220
31 3300009148 Ga0105243_10006175 Ga0105243_1000617510 220
32 3300025903 Ga0207680_10005958 Ga0207680_100059584 220
33 3300025920 Ga0207649_10000166 Ga0207649_1000016613 220
34 3300025926 Ga0207659_10000138 Ga0207659_1000013830 220
35 3300025928 Ga0207700_10000019 Ga0207700_10000019172 220
36 3300025935 Ga0207709_10002223 Ga0207709_1000222310 220
37 3300046511 Ga0495608_0000010 Ga0495608_0000010_251089_251754 220
38 3300046516 Ga0495628_0000864 Ga0495628_0000864_27069_27734 220
39 3300046675 Ga0495657_0000005 Ga0495657_0000005_3107_3772 220
40 3300046689 Ga0495613_0000087 Ga0495613_0000087_87786_88451 220
41 3300046809 Ga0495600_0005362 Ga0495600_0005362_5103_5768 220
42 3300047317 Ga0495604_0000322 Ga0495604_0000322_12434_13099 220
43 3300047444 Ga0495675_0024971 Ga0495675_0024971_53_718 220
44 3300048088 Ga0495602_0000038 Ga0495602_0000038_28941_29606 220
45 3300048088 Ga0495602_0003702 Ga0495602_0003702_15052_15717 220
46 3300053077 Ga0495601_0000698 Ga0495601_0000698_11012_11677 220
47 3300053084 Ga0495595_0000005 Ga0495595_0000005_6907_7572 220
48 3300053084 Ga0495595_0006235 Ga0495595_0006235_3926_4591 220
49 3300053085 Ga0495619_0024714 Ga0495619_0024714_75_740 220
50 iso_pu_bacteria 2808606414 2809125332 220
51 3300005329 Ga0070683_100007065 Ga0070683_10000706510 221
52 3300005347 Ga0070668_100864517 Ga0070668_1008645171 221
53 3300005535 Ga0070684_100248531 Ga0070684_1002485312 221
54 3300005841 Ga0068863_100008951 Ga0068863_1000089517 221
55 3300005937 Ga0081455_10030975 Ga0081455_100309751 221
56 3300013307 Ga0157372_10000809 Ga0157372_1000080928 221
57 3300025900 Ga0207710_10279714 Ga0207710_102797141 221
58 3300025944 Ga0207661_10000616 Ga0207661_1000061614 221
59 3300026088 Ga0207641_10015727 Ga0207641_100157274 221
60 3300028556 Ga0265337_1000032 Ga0265337_100003211 221
61 3300028558 Ga0265326_10000040 Ga0265326_1000004030 221
62 3300028654 Ga0265322_10000012 Ga0265322_1000001253 221
63 3300028666 Ga0265336_10001404 Ga0265336_1000140411 221
64 3300029957 Ga0265324_10000202 Ga0265324_1000020242 221
65 3300031240 Ga0265320_10000001 Ga0265320_10000001753 221
66 3300031242 Ga0265329_10039576 Ga0265329_100395763 221
67 3300031250 Ga0265331_10001467 Ga0265331_1000146729 221
68 3300031251 Ga0265327_10000003 Ga0265327_10000003753 221
69 3300031344 Ga0265316_10022318 Ga0265316_100223188 221
70 3300031711 Ga0265314_10000178 Ga0265314_1000017838 221
71 3300047321 Ga0495676_0034901 Ga0495676_0034901_1876_2541 221
72 3300047673 Ga0495593_0056805 Ga0495593_0056805_1146_1814 221
73 3300048917 Ga0496114_0062679 Ga0496114_0062679_1713_2384 221
74 3300005337 Ga0070682_100000032 Ga0070682_100000032149 222
75 3300005340 Ga0070689_100046525 Ga0070689_1000465252 222
76 3300005341 Ga0070691_10000003 Ga0070691_1000000391 222
77 3300005355 Ga0070671_100170092 Ga0070671_1001700922 222
78 3300005365 Ga0070688_100063310 Ga0070688_1000633101 222
79 3300005367 Ga0070667_100090916 Ga0070667_1000909163 222
80 3300005437 Ga0070710_10036170 Ga0070710_100361703 222
81 3300005456 Ga0070678_100107182 Ga0070678_1001071823 222
82 3300005466 Ga0070685_10082670 Ga0070685_100826702 222
83 3300005539 Ga0068853_100341918 Ga0068853_1003419182 222
84 3300005548 Ga0070665_100033969 Ga0070665_1000339692 222
85 3300005548 Ga0070665_100051471 Ga0070665_1000514714 222
86 3300005577 Ga0068857_100120727 Ga0068857_1001207273 222
87 3300005578 Ga0068854_100000939 Ga0068854_10000093911 222
88 3300005616 Ga0068852_100249229 Ga0068852_1002492292 222
89 3300005834 Ga0068851_10000247 Ga0068851_1000024727 222
90 3300005841 Ga0068863_100128271 Ga0068863_1001282713 222
91 3300013104 Ga0157370_10031292 Ga0157370_100312928 222
92 3300013104 Ga0157370_10339829 Ga0157370_103398292 222
93 3300013308 Ga0157375_10758890 Ga0157375_107588901 222
94 3300014326 Ga0157380_10000326 Ga0157380_100003268 222
95 3300014326 Ga0157380_10201317 Ga0157380_102013172 222
96 3300014968 Ga0157379_10125618 Ga0157379_101256184 222
97 3300014969 Ga0157376_10028749 Ga0157376_100287493 222
98 3300025321 Ga0207656_10000374 Ga0207656_1000037412 222
99 3300025898 Ga0207692_10079159 Ga0207692_100791592 222
100 3300025931 Ga0207644_10124256 Ga0207644_101242562 222
101 3300025934 Ga0207686_10026039 Ga0207686_100260393 222
102 3300025981 Ga0207640_10000821 Ga0207640_1000082116 222
103 3300025986 Ga0207658_10093359 Ga0207658_100933593 222
104 3300026088 Ga0207641_10045909 Ga0207641_100459093 222
105 3300026121 Ga0207683_10111504 Ga0207683_101115044 222
106 3300026142 Ga0207698_10259023 Ga0207698_102590232 222
107 3300028379 Ga0268266_10018264 Ga0268266_100182643 222
108 3300028379 Ga0268266_10055970 Ga0268266_100559703 222
109 3300041460 Ga0451802_1687494 Ga0451802_1687494_318_989 222
110 3300041512 Ga0451853_2894472 Ga0451853_2894472_4061_4729 222
111 3300045836 Ga0466958_0093805 Ga0466958_0093805_1101_1772 222
112 3300045976 Ga0466967_0000003 Ga0466967_0000003_32387_33058 222
113 3300046473 Ga0495582_0002254 Ga0495582_0002254_3431_4099 222
114 3300046499 Ga0495594_0000001 Ga0495594_0000001_42114_42782 222
115 3300046507 Ga0495606_0000283 Ga0495606_0000283_50126_50797 222
116 3300046512 Ga0495610_0010836 Ga0495610_0010836_4088_4759 222
117 3300046515 Ga0495620_0057580 Ga0495620_0057580_169_837 222
118 3300046517 Ga0495630_0427742 Ga0495630_0427742_63_731 222
119 3300046529 Ga0495652_0000009 Ga0495652_0000009_219593_220264 222
120 3300046533 Ga0495640_0037352 Ga0495640_0037352_1977_2648 222
121 3300046536 Ga0495587_0029873 Ga0495587_0029873_124_792 222
122 3300046536 Ga0495587_0054173 Ga0495587_0054173_1642_2313 222
123 3300046683 Ga0495658_0001854 Ga0495658_0001854_3431_4099 222
124 3300046690 Ga0495624_0000429 Ga0495624_0000429_9287_9958 222
125 3300047317 Ga0495604_0000928 Ga0495604_0000928_15281_15949 222
126 3300047319 Ga0495674_0000141 Ga0495674_0000141_22334_23005 222
127 3300047320 Ga0495672_0183110 Ga0495672_0183110_160_831 222
128 3300047444 Ga0495675_0129871 Ga0495675_0129871_318_989 222
129 3300048088 Ga0495602_0037972 Ga0495602_0037972_2985_3656 222
130 3300048905 Ga0496102_0316541 Ga0496102_0316541_15_686 222
131 3300048907 Ga0496104_0000029 Ga0496104_0000029_181303_181974 222
132 3300048907 Ga0496104_0004081 Ga0496104_0004081_5134_5805 222
133 3300048907 Ga0496104_0659837 Ga0496104_0659837_114_782 222
134 3300048908 Ga0496105_0000002 Ga0496105_0000002_181303_181974 222
135 3300048908 Ga0496105_0000070 Ga0496105_0000070_67064_67735 222
136 3300048911 Ga0496108_0000042 Ga0496108_0000042_112772_113443 222
137 3300048911 Ga0496108_0002451 Ga0496108_0002451_2398_3069 222
138 3300048912 Ga0496109_0000034 Ga0496109_0000034_145411_146082 222
139 3300048912 Ga0496109_0000062 Ga0496109_0000062_4963_5634 222
140 3300048912 Ga0496109_0087121 Ga0496109_0087121_248_916 222
141 3300048913 Ga0496110_0000325 Ga0496110_0000325_13047_13718 222
142 3300048914 Ga0496111_0000171 Ga0496111_0000171_15889_16560 222
143 3300048914 Ga0496111_0036271 Ga0496111_0036271_1830_2498 222
144 3300048915 Ga0496112_0100635 Ga0496112_0100635_2068_2736 222
145 3300048916 Ga0496113_0000002 Ga0496113_0000002_28696_29367 222
146 3300048916 Ga0496113_0087777 Ga0496113_0087777_914_1582 222
147 3300048922 Ga0496119_0014960 Ga0496119_0014960_1811_2482 222
148 3300049586 Ga0501070_0064865 Ga0501070_0064865_198_869 222
149 3300053077 Ga0495601_0131084 Ga0495601_0131084_119_790 222
150 3300053083 Ga0495655_0000120 Ga0495655_0000120_272_943 222
151 3300053085 Ga0495619_0000069 Ga0495619_0000069_58942_59613 222
152 3300053085 Ga0495619_0026792 Ga0495619_0026792_681_1349 222
153 3300005535 Ga0070684_100065586 Ga0070684_1000655862 223
154 3300005564 Ga0070664_100085966 Ga0070664_1000859662 223
155 3300005843 Ga0068860_100335646 Ga0068860_1003356462 223
156 3300009176 Ga0105242_10000123 Ga0105242_1000012326 223
157 3300025944 Ga0207661_10369223 Ga0207661_103692232 223
158 3300025945 Ga0207679_10189407 Ga0207679_101894072 223
159 3300045836 Ga0466958_0007909 Ga0466958_0007909_2806_3480 223
160 3300046684 Ga0495669_0031979 Ga0495669_0031979_1169_1846 223
161 3300047320 Ga0495672_0024804 Ga0495672_0024804_908_1579 223
162 3300053078 Ga0495612_0001451 Ga0495612_0001451_2418_3092 223
163 3300000546 LJNas_1002420 LJNas_10024203 224
164 3300005435 Ga0070714_100036840 Ga0070714_1000368401 224
165 3300005614 Ga0068856_100007857 Ga0068856_1000078574 224
166 3300009101 Ga0105247_10101811 Ga0105247_101018112 224
167 3300009176 Ga0105242_10000589 Ga0105242_100005893 224
168 3300013308 Ga0157375_10016258 Ga0157375_100162587 224
169 3300025929 Ga0207664_10013567 Ga0207664_100135674 224
170 3300026078 Ga0207702_10002042 Ga0207702_1000204214 224
171 3300047320 Ga0495672_0056693 Ga0495672_0056693_938_1615 224
172 3300048911 Ga0496108_0240591 Ga0496108_0240591_784_1464 224
173 3300048915 Ga0496112_0536486 Ga0496112_0536486_124_804 224
174 3300048916 Ga0496113_0029367 Ga0496113_0029367_63_743 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01596

Methyltransf_3

O-methyltransferase

26

229

0.9

PF13578

Methyltransf_24

Methyltransferase domain

74

177

0.9

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

49

178

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3duw-assembly1.cif.gz_B crystal structural analysis of the o-methyltransferase from bacillus cereus in complex sah 0.9845 4 223
3duw-assembly1.cif.gz_B crystal structural analysis of the o-methyltransferase from bacillus cereus in complex sah 0.9801 4 223
3tfw-assembly1.cif.gz_B-2 crystal structure of a putative o-methyltransferase from klebsiella pneumoniae 0.9769 5 224
7cvv-assembly1.cif.gz_A crystal structure of catechol o-methyl transferase (comt) from niastella koreensis 0.9745 6 223
8c9t-assembly2.cif.gz_B catechol o-methyltransferase from streptomyces avermitilis 0.9742 4 224
ID Description Score Start End Superfamily
af_O07431_3_220_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9687 9 223 3.40.50.150
af_O07431_3_220_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9342 9 223 3.40.50.150
3dulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.934 10 223 3.40.50.150
3dulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9161 10 223 3.40.50.150
af_Q9M266_77_290_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9101 11 223 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7K4FH96-F1-model_v4 O-methyltransferase 0.9956 10 89 GO:0008171
GO:0032259
AF-A0A6G3D0R8-F1-model_v4 Methyltransferase 0.9943 10 143 GO:0008171
GO:0008757
GO:0032259
AF-A0A7K3GB78-F1-model_v4 Methyltransferase domain-containing protein 0.9899 3 223 GO:0008171
GO:0008757
GO:0032259
AF-A0A7V8Y9J2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9896 3 158 GO:0008171
GO:0008757
GO:0032259
AF-A0A6D0ENJ7-F1-model_v4 deleted 0.9874 4 164

Feature Viewer

pLDDT pTM Quality
93.29 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map