F263592

General Info

Members Datasets Scaffolds Average Seq Length
173 125 168 252

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2919138771|2919141149
Length 277
Sequence LFRAYRDLLAHSPEEDVVMPETVTTSYFRGWAGTRLALHRMGPASGGSGRPLLLFHGLFSSAAINWVKYGHAERLAQAGFEVIMPDLRAHGMSEAPHDATAYPEDVLVTDALMLVRELGFEPGGFDLGGFSLGSRTATRAVLAGLEPRRLVLAGMGLEGLAGWARRSAFFLDAIARYGTIKHGDPAYVAQQFMKAQKVDLRAAELLLQSVDDTPPSDLAGITMPTLVVCGAIDQDNGSAPRLAQTLPNARYAEIPGTHMSSVTQKELGQQMVEFLTS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
3 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
4 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
5 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
6 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
71 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
72 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
73 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
74 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
75 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
78 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
79 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
80 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
81 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
84 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
85 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
86 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
87 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
97 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
98 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
99 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
100 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
101 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
102 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
109 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
110 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
111 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
112 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
118 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
119 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
120 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
121 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
122 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
123 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
124 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
125 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.11
Metatranscriptomes 0
Isolates 2.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.94
Nodule 0
Rhizoplane 5.78
Rhizosphere 71.68
Stem 0
Stem Tuber 0
Unclassified 15.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3540226 2162886007 Bacteria 4193
2 Ga0055537_1007060 3300003773 Bacteria 2762
3 Ga0055530_10002492 3300003791 Bacteria 11790
4 Ga0065704_10070744 3300005289 Bacteria 16791
5 Ga0065704_10075395 3300005289 Bacteria 5604
6 Ga0070658_10000001 3300005327 Bacteria 856789
7 Ga0070658_10220585 3300005327 Bacteria 1603
8 Ga0070658_10300177 3300005327 Bacteria 1369
9 Ga0070683_100231560 3300005329 Bacteria 1756
10 Ga0070666_10029018 3300005335 Bacteria 3635
11 Ga0070666_10095129 3300005335 Bacteria 2050
12 Ga0070666_10110545 3300005335 Bacteria 1900
13 Ga0070680_100001157 3300005336 Bacteria 18957
14 Ga0068868_100003488 3300005338 Bacteria 10944
15 Ga0070660_100004165 3300005339 Bacteria 9989
16 Ga0070668_100000646 3300005347 Bacteria 23522
17 Ga0070668_100004087 3300005347 Bacteria 10803
18 Ga0070668_100200310 3300005347 Bacteria 1639
19 Ga0070669_100001232 3300005353 Bacteria 18563
20 Ga0070669_100008130 3300005353 Bacteria 7494
21 Ga0070669_100060657 3300005353 Bacteria 2779
22 Ga0070671_100013052 3300005355 Bacteria 6696
23 Ga0070671_100023252 3300005355 Bacteria 5071
24 Ga0070667_100000067 3300005367 Bacteria 133023
25 Ga0070667_100001292 3300005367 Bacteria 22636
26 Ga0070667_100213353 3300005367 Bacteria 1716
27 Ga0070663_100071451 3300005455 Bacteria 2525
28 Ga0070678_100110792 3300005456 Bacteria 2147
29 Ga0070662_100010485 3300005457 Bacteria 6084
30 Ga0070684_100042035 3300005535 Bacteria 3944
31 Ga0070665_100002933 3300005548 Bacteria 18422
32 Ga0070665_100032391 3300005548 Bacteria 5260
33 Ga0068855_100085540 3300005563 Bacteria 3648
34 Ga0068855_100131748 3300005563 Bacteria 2855
35 Ga0068863_100000038 3300005841 Bacteria 161477
36 Ga0068863_100008950 3300005841 Bacteria 9776
37 Ga0068858_100071441 3300005842 Bacteria 3219
38 Ga0068858_100097861 3300005842 Bacteria 2735
39 Ga0068860_100050325 3300005843 Bacteria 3967
40 Ga0068862_100004266 3300005844 Bacteria 12103
41 Ga0075364_10112476 3300006051 Bacteria 1818
42 Ga0105251_10004297 3300009011 Bacteria 9777
43 Ga0114129_10810171 3300009147 Bacteria 1194
44 Ga0105248_10040038 3300009177 Bacteria 5252
45 Ga0105249_10274666 3300009553 Bacteria 1680
46 Ga0157370_10141891 3300013104 Bacteria 2238
47 Ga0157369_10012576 3300013105 Bacteria 9601
48 Ga0157380_11114362 3300014326 Bacteria 829
49 Ga0163161_10029818 3300017792 Bacteria 3877
50 Ga0207696_1030841 3300025711 Bacteria 1626
51 Ga0207713_1002611 3300025735 Bacteria 12984
52 Ga0207713_1025247 3300025735 Bacteria 2750
53 Ga0207713_1098548 3300025735 Bacteria 1013
54 Ga0207680_10015555 3300025903 Bacteria 3973
55 Ga0207680_10023993 3300025903 Bacteria 3340
56 Ga0207680_10168896 3300025903 Bacteria 1472
57 Ga0207657_10022107 3300025919 Bacteria 5969
58 Ga0207657_10182721 3300025919 Bacteria 1694
59 Ga0207652_10356721 3300025921 Bacteria 1320
60 Ga0207681_10000259 3300025923 Bacteria 40452
61 Ga0207681_10007951 3300025923 Bacteria 6483
62 Ga0207681_10011321 3300025923 Bacteria 5480
63 Ga0207650_10168954 3300025925 Bacteria 1737
64 Ga0207644_10003746 3300025931 Bacteria 9848
65 Ga0207644_10008789 3300025931 Bacteria 6613
66 Ga0207711_10101415 3300025941 Bacteria 2547
67 Ga0207661_10287676 3300025944 Bacteria 1470
68 Ga0207667_10032150 3300025949 Bacteria 5657
69 Ga0207712_10121948 3300025961 Bacteria 1973
70 Ga0207668_10000629 3300025972 Bacteria 21816
71 Ga0207668_10003159 3300025972 Bacteria 9645
72 Ga0207668_10282192 3300025972 Bacteria 1362
73 Ga0207640_10009509 3300025981 Bacteria 5445
74 Ga0207658_10000089 3300025986 Bacteria 100308
75 Ga0207658_10002564 3300025986 Bacteria 13198
76 Ga0207658_10012206 3300025986 Bacteria 5863
77 Ga0207703_10121711 3300026035 Bacteria 2241
78 Ga0207703_10330008 3300026035 Bacteria 1399
79 Ga0207678_10018339 3300026067 Bacteria 6148
80 Ga0207641_10000060 3300026088 Bacteria 161514
81 Ga0207641_10055924 3300026088 Bacteria 3351
82 Ga0207674_10252403 3300026116 Bacteria 1711
83 Ga0207683_10151371 3300026121 Bacteria 2094
84 Ga0268266_10004036 3300028379 Bacteria 14190
85 Ga0268266_10011818 3300028379 Bacteria 7568
86 Ga0268265_10006174 3300028380 Bacteria 8115
87 Ga0268265_10072907 3300028380 Bacteria 2679
88 Ga0268264_10039664 3300028381 Bacteria 3891
89 Ga0265327_10072893 3300031251 Bacteria 1714
90 Ga0307408_100129590 3300031548 Unclassified 1966
91 Ga0307405_10000391 3300031731 Bacteria 16410
92 Ga0307406_10350281 3300031901 Bacteria 1154
93 Ga0307412_10010587 3300031911 Bacteria 5314
94 Ga0307412_10124793 3300031911 Bacteria 1860
95 Ga0307416_100315037 3300032002 Bacteria 1563
96 Ga0307414_10009517 3300032004 Bacteria 5588
97 Ga0307411_10148735 3300032005 Bacteria 1738
98 Ga0307411_10361211 3300032005 Bacteria 1188
99 Ga0439461_0014672 3300041410 Bacteria 1493
100 Ga0439465_0010257 3300041413 Bacteria 2945
101 Ga0451841_0681036 3300041498 Unclassified 758
102 Ga0439445_0010593 3300042004 Bacteria 2184
103 Ga0439457_009132 3300042014 Bacteria 2315
104 Ga0495617_019658 3300046452 Bacteria 2283
105 Ga0495638_0000016 3300046460 Bacteria 396505
106 Ga0495650_0012961 3300046471 Bacteria 4445
107 Ga0495639_0063964 3300046475 Unclassified 1690
108 Ga0495583_0011021 3300046506 Bacteria 5213
109 Ga0495632_0011966 3300046519 Bacteria 5032
110 Ga0495643_0075551 3300046522 Bacteria 1763
111 Ga0495648_0000101 3300046524 Bacteria 107124
112 Ga0495621_0037604 3300046539 Bacteria 1684
113 Ga0495633_0043563 3300046558 Bacteria 2129
114 Ga0495671_0000063 3300046692 Bacteria 106655
115 Ga0495673_0000170 3300047469 Bacteria 106688
116 Ga0496100_0069019 3300048903 Bacteria 2352
117 Ga0496101_0001612 3300048904 Bacteria 13571
118 Ga0496102_0000106 3300048905 Bacteria 118841
119 Ga0496103_0000095 3300048906 Bacteria 98260
120 Ga0496103_0148507 3300048906 Bacteria 1501
121 Ga0496104_0000060 3300048907 Bacteria 117966
122 Ga0496105_0000274 3300048908 Bacteria 34048
123 Ga0496107_0004473 3300048910 Bacteria 9480
124 Ga0496113_0003962 3300048916 Bacteria 8994
125 Ga0496114_0329286 3300048917 Bacteria 1350
126 Ga0496117_0000366 3300048920 Bacteria 78816
127 Ga0496118_0160894 3300048921 Bacteria 1388
128 Ga0496119_0001213 3300048922 Bacteria 32201
129 Ga0496119_0139960 3300048922 Bacteria 1308
130 Ga0496120_0001109 3300048923 Bacteria 35064
131 Ga0496120_0061584 3300048923 Bacteria 2094
132 Ga0496121_0002522 3300048924 Bacteria 27770
133 Ga0496121_0013959 3300048924 Bacteria 8580
134 Ga0496121_0055049 3300048924 Bacteria 3318
135 Ga0496122_0004287 3300048925 Bacteria 17866
136 Ga0496123_0079327 3300048926 Bacteria 2006
137 Ga0496124_0001819 3300048927 Bacteria 29505
138 Ga0496124_0344128 3300048927 Bacteria 1057
139 Ga0496124_0351913 3300048927 Bacteria 1042
140 Ga0496124_0423433 3300048927 Bacteria 916
141 Ga0496125_0090815 3300048928 Bacteria 2290
142 Ga0496125_0092872 3300048928 Bacteria 2254
143 Ga0496125_0116330 3300048928 Bacteria 1920
144 Ga0496125_0138923 3300048928 Bacteria 1693
145 Ga0496126_0000294 3300048929 Bacteria 106327
146 Ga0496126_0091916 3300048929 Bacteria 2667
147 Ga0496126_0358150 3300048929 Bacteria 1192
148 Ga0496126_0683181 3300048929 Unclassified 800
149 Ga0501034_0099429 3300049571 Bacteria 2903
150 Ga0501042_0160581 3300049578 Bacteria 1622
151 Ga0501223_000495 3300049663 Bacteria 9553
152 Ga0501224_000006 3300049664 Bacteria 149611
153 Ga0501233_000165 3300049668 Bacteria 9518
154 Ga0501225_0000845 3300049705 Bacteria 9521
155 Ga0501234_001735 3300049707 Bacteria 3427
156 Ga0501035_0467077 3300049822 Bacteria 1042
157 Ga0501044_0790570 3300049823 Bacteria 829
158 Ga0501226_000208 3300049853 Bacteria 9283
159 nmdc:mga05p37_639222_c1 3300050507 Bacteria 1194
160 Ga0500594_0014182 3300053118 Bacteria 1905
161 Ga0500607_002875 3300053121 Bacteria 13266
162 Ga0500608_004409 3300053122 Bacteria 5446
163 Ga0500618_000868 3300053125 Bacteria 16150
164 Ga0500559_0121230 3300053136 Bacteria 1216
165 Ga0500564_024036 3300053138 Bacteria 2795
166 Ga0500573_0021237 3300053140 Bacteria 3720
167 Ga0500567_000103 3300053723 Bacteria 21300
168 Ga0500625_000029 3300053729 Bacteria 54479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025921 Ga0207652_10356721 Ga0207652_103567212 210
2 3300049823 Ga0501044_0790570 Ga0501044_0790570_159_794 211
3 3300048929 Ga0496126_0683181 Ga0496126_0683181_41_709 222
4 3300041498 Ga0451841_0681036 Ga0451841_0681036_30_701 223
5 3300025919 Ga0207657_10022107 Ga0207657_100221075 224
6 3300014326 Ga0157380_11114362 Ga0157380_111143621 230
7 3300009147 Ga0114129_10810171 Ga0114129_108101712 232
8 3300050507 nmdc:mga05p37_639222_c1 nmdc:mga05p37_639222_c1_243_989 232
9 3300053136 Ga0500559_0121230 Ga0500559_0121230_316_1059 235
10 3300048927 Ga0496124_0351913 Ga0496124_0351913_237_953 237
11 3300005455 Ga0070663_100071451 Ga0070663_1000714514 239
12 3300005457 Ga0070662_100010485 Ga0070662_1000104858 239
13 3300025919 Ga0207657_10182721 Ga0207657_101827212 239
14 3300026067 Ga0207678_10018339 Ga0207678_100183398 239
15 3300048928 Ga0496125_0116330 Ga0496125_0116330_720_1475 240
16 3300026116 Ga0207674_10252403 Ga0207674_102524032 243
17 3300046471 Ga0495650_0012961 Ga0495650_0012961_3137_3871 244
18 iso_pu_bacteria 3000865235 3000865765 244
19 3300005338 Ga0068868_100003488 Ga0068868_1000034887 246
20 iso_pu_bacteria 2848297114 2848299118 246
21 3300005327 Ga0070658_10000001 Ga0070658_10000001527 248
22 3300031251 Ga0265327_10072893 Ga0265327_100728932 248
23 3300049571 Ga0501034_0099429 Ga0501034_0099429_410_1168 248
24 3300005844 Ga0068862_100004266 Ga0068862_1000042662 249
25 3300025981 Ga0207640_10009509 Ga0207640_100095096 249
26 3300028380 Ga0268265_10006174 Ga0268265_100061744 249
27 3300046522 Ga0495643_0075551 Ga0495643_0075551_323_1072 249
28 3300048906 Ga0496103_0148507 Ga0496103_0148507_498_1250 249
29 3300003773 Ga0055537_1007060 Ga0055537_10070604 250
30 3300003791 Ga0055530_10002492 Ga0055530_100024926 250
31 3300005289 Ga0065704_10075395 Ga0065704_100753955 250
32 3300005327 Ga0070658_10220585 Ga0070658_102205852 250
33 3300005327 Ga0070658_10300177 Ga0070658_103001772 250
34 3300005329 Ga0070683_100231560 Ga0070683_1002315602 250
35 3300005335 Ga0070666_10029018 Ga0070666_100290182 250
36 3300005335 Ga0070666_10095129 Ga0070666_100951292 250
37 3300005336 Ga0070680_100001157 Ga0070680_10000115722 250
38 3300005339 Ga0070660_100004165 Ga0070660_10000416510 250
39 3300005347 Ga0070668_100004087 Ga0070668_1000040874 250
40 3300005347 Ga0070668_100200310 Ga0070668_1002003102 250
41 3300005353 Ga0070669_100008130 Ga0070669_1000081305 250
42 3300005353 Ga0070669_100060657 Ga0070669_1000606572 250
43 3300005355 Ga0070671_100013052 Ga0070671_1000130525 250
44 3300005367 Ga0070667_100000067 Ga0070667_10000006780 250
45 3300005367 Ga0070667_100213353 Ga0070667_1002133531 250
46 3300005456 Ga0070678_100110792 Ga0070678_1001107922 250
47 3300005535 Ga0070684_100042035 Ga0070684_1000420355 250
48 3300005548 Ga0070665_100002933 Ga0070665_1000029339 250
49 3300005563 Ga0068855_100085540 Ga0068855_1000855404 250
50 3300005841 Ga0068863_100000038 Ga0068863_10000003878 250
51 3300005841 Ga0068863_100008950 Ga0068863_1000089504 250
52 3300005842 Ga0068858_100071441 Ga0068858_1000714412 250
53 3300005843 Ga0068860_100050325 Ga0068860_1000503256 250
54 3300006051 Ga0075364_10112476 Ga0075364_101124762 250
55 3300009011 Ga0105251_10004297 Ga0105251_100042972 250
56 3300017792 Ga0163161_10029818 Ga0163161_100298182 250
57 3300025735 Ga0207713_1002611 Ga0207713_10026115 250
58 3300025903 Ga0207680_10015555 Ga0207680_100155555 250
59 3300025903 Ga0207680_10023993 Ga0207680_100239932 250
60 3300025923 Ga0207681_10007951 Ga0207681_100079518 250
61 3300025923 Ga0207681_10011321 Ga0207681_100113212 250
62 3300025925 Ga0207650_10168954 Ga0207650_101689543 250
63 3300025931 Ga0207644_10003746 Ga0207644_100037463 250
64 3300025944 Ga0207661_10287676 Ga0207661_102876762 250
65 3300025949 Ga0207667_10032150 Ga0207667_100321504 250
66 3300025972 Ga0207668_10000629 Ga0207668_1000062913 250
67 3300025972 Ga0207668_10282192 Ga0207668_102821922 250
68 3300025986 Ga0207658_10000089 Ga0207658_1000008953 250
69 3300025986 Ga0207658_10012206 Ga0207658_100122065 250
70 3300026035 Ga0207703_10330008 Ga0207703_103300081 250
71 3300026088 Ga0207641_10000060 Ga0207641_1000006083 250
72 3300026088 Ga0207641_10055924 Ga0207641_100559243 250
73 3300026121 Ga0207683_10151371 Ga0207683_101513712 250
74 3300028379 Ga0268266_10004036 Ga0268266_100040368 250
75 3300028381 Ga0268264_10039664 Ga0268264_100396646 250
76 3300031548 Ga0307408_100129590 Ga0307408_1001295902 250
77 3300031901 Ga0307406_10350281 Ga0307406_103502812 250
78 3300031911 Ga0307412_10124793 Ga0307412_101247932 250
79 3300032002 Ga0307416_100315037 Ga0307416_1003150372 250
80 3300032004 Ga0307414_10009517 Ga0307414_100095172 250
81 3300032005 Ga0307411_10148735 Ga0307411_101487353 250
82 3300032005 Ga0307411_10361211 Ga0307411_103612112 250
83 3300041410 Ga0439461_0014672 Ga0439461_0014672_523_1284 250
84 3300041413 Ga0439465_0010257 Ga0439465_0010257_1694_2455 250
85 3300042004 Ga0439445_0010593 Ga0439445_0010593_590_1351 250
86 3300042014 Ga0439457_009132 Ga0439457_009132_457_1230 250
87 3300046452 Ga0495617_019658 Ga0495617_019658_307_1089 250
88 3300046460 Ga0495638_0000016 Ga0495638_0000016_3957_4739 250
89 3300046506 Ga0495583_0011021 Ga0495583_0011021_3830_4612 250
90 3300046519 Ga0495632_0011966 Ga0495632_0011966_3585_4367 250
91 3300046524 Ga0495648_0000101 Ga0495648_0000101_3703_4485 250
92 3300046539 Ga0495621_0037604 Ga0495621_0037604_73_828 250
93 3300046558 Ga0495633_0043563 Ga0495633_0043563_440_1222 250
94 3300046692 Ga0495671_0000063 Ga0495671_0000063_101936_102718 250
95 3300047469 Ga0495673_0000170 Ga0495673_0000170_102026_102808 250
96 3300048917 Ga0496114_0329286 Ga0496114_0329286_394_1149 250
97 3300048922 Ga0496119_0139960 Ga0496119_0139960_460_1215 250
98 3300048923 Ga0496120_0061584 Ga0496120_0061584_762_1517 250
99 3300048924 Ga0496121_0055049 Ga0496121_0055049_1804_2559 250
100 3300048927 Ga0496124_0344128 Ga0496124_0344128_141_896 250
101 3300048928 Ga0496125_0092872 Ga0496125_0092872_510_1265 250
102 3300048928 Ga0496125_0138923 Ga0496125_0138923_26_802 250
103 3300048929 Ga0496126_0091916 Ga0496126_0091916_1078_1833 250
104 3300048929 Ga0496126_0358150 Ga0496126_0358150_206_961 250
105 3300049663 Ga0501223_000495 Ga0501223_000495_6768_7547 250
106 3300049664 Ga0501224_000006 Ga0501224_000006_142102_142881 250
107 3300049668 Ga0501233_000165 Ga0501233_000165_2012_2791 250
108 3300049705 Ga0501225_0000845 Ga0501225_0000845_6736_7515 250
109 3300049707 Ga0501234_001735 Ga0501234_001735_1705_2484 250
110 3300049822 Ga0501035_0467077 Ga0501035_0467077_187_942 250
111 3300049853 Ga0501226_000208 Ga0501226_000208_6735_7514 250
112 3300053121 Ga0500607_002875 Ga0500607_002875_10804_11571 250
113 3300053125 Ga0500618_000868 Ga0500618_000868_15303_16106 250
114 iso_pu_bacteria 2919138771 2919141149 250
115 3300013104 Ga0157370_10141891 Ga0157370_101418914 251
116 3300048924 Ga0496121_0002522 Ga0496121_0002522_14121_14882 251
117 2162886007 SwRhRL2b_contig_3540226 SwRhRL2b_0218.00007630 252
118 3300005289 Ga0065704_10070744 Ga0065704_1007074421 252
119 3300005335 Ga0070666_10110545 Ga0070666_101105452 252
120 3300005347 Ga0070668_100000646 Ga0070668_1000006468 252
121 3300005353 Ga0070669_100001232 Ga0070669_10000123212 252
122 3300005355 Ga0070671_100023252 Ga0070671_1000232522 252
123 3300005367 Ga0070667_100001292 Ga0070667_1000012924 252
124 3300005548 Ga0070665_100032391 Ga0070665_1000323916 252
125 3300005563 Ga0068855_100131748 Ga0068855_1001317484 252
126 3300005842 Ga0068858_100097861 Ga0068858_1000978611 252
127 3300009177 Ga0105248_10040038 Ga0105248_100400386 252
128 3300009553 Ga0105249_10274666 Ga0105249_102746662 252
129 3300013105 Ga0157369_10012576 Ga0157369_100125767 252
130 3300025711 Ga0207696_1030841 Ga0207696_10308412 252
131 3300025735 Ga0207713_1025247 Ga0207713_10252474 252
132 3300025735 Ga0207713_1098548 Ga0207713_10985482 252
133 3300025903 Ga0207680_10168896 Ga0207680_101688961 252
134 3300025923 Ga0207681_10000259 Ga0207681_100002597 252
135 3300025931 Ga0207644_10008789 Ga0207644_100087893 252
136 3300025941 Ga0207711_10101415 Ga0207711_101014151 252
137 3300025961 Ga0207712_10121948 Ga0207712_101219482 252
138 3300025972 Ga0207668_10003159 Ga0207668_100031595 252
139 3300025986 Ga0207658_10002564 Ga0207658_1000256413 252
140 3300026035 Ga0207703_10121711 Ga0207703_101217111 252
141 3300028379 Ga0268266_10011818 Ga0268266_100118182 252
142 3300028380 Ga0268265_10072907 Ga0268265_100729072 252
143 3300031731 Ga0307405_10000391 Ga0307405_100003916 252
144 3300031911 Ga0307412_10010587 Ga0307412_100105875 252
145 3300046475 Ga0495639_0063964 Ga0495639_0063964_341_1114 252
146 3300048903 Ga0496100_0069019 Ga0496100_0069019_1229_1987 252
147 3300048904 Ga0496101_0001612 Ga0496101_0001612_3888_4646 252
148 3300048905 Ga0496102_0000106 Ga0496102_0000106_62645_63403 252
149 3300048906 Ga0496103_0000095 Ga0496103_0000095_40626_41384 252
150 3300048907 Ga0496104_0000060 Ga0496104_0000060_25544_26302 252
151 3300048908 Ga0496105_0000274 Ga0496105_0000274_19749_20507 252
152 3300048910 Ga0496107_0004473 Ga0496107_0004473_4575_5333 252
153 3300048916 Ga0496113_0003962 Ga0496113_0003962_8169_8927 252
154 3300048920 Ga0496117_0000366 Ga0496117_0000366_57572_58330 252
155 3300048921 Ga0496118_0160894 Ga0496118_0160894_563_1321 252
156 3300048922 Ga0496119_0001213 Ga0496119_0001213_10076_10834 252
157 3300048923 Ga0496120_0001109 Ga0496120_0001109_20765_21523 252
158 3300048924 Ga0496121_0013959 Ga0496121_0013959_6310_7068 252
159 3300048925 Ga0496122_0004287 Ga0496122_0004287_16351_17109 252
160 3300048926 Ga0496123_0079327 Ga0496123_0079327_1229_1987 252
161 3300048927 Ga0496124_0001819 Ga0496124_0001819_25083_25841 252
162 3300048927 Ga0496124_0423433 Ga0496124_0423433_123_881 252
163 3300048928 Ga0496125_0090815 Ga0496125_0090815_1513_2271 252
164 3300048929 Ga0496126_0000294 Ga0496126_0000294_51075_51833 252
165 3300049578 Ga0501042_0160581 Ga0501042_0160581_323_1084 252
166 3300053118 Ga0500594_0014182 Ga0500594_0014182_842_1615 252
167 3300053122 Ga0500608_004409 Ga0500608_004409_3613_4386 252
168 3300053138 Ga0500564_024036 Ga0500564_024036_1296_2069 252
169 3300053140 Ga0500573_0021237 Ga0500573_0021237_1867_2640 252
170 3300053723 Ga0500567_000103 Ga0500567_000103_19295_20068 252
171 3300053729 Ga0500625_000029 Ga0500625_000029_6565_7338 252
172 iso_pu_bacteria 2739367664 2739650374 252
173 iso_pu_bacteria 2739367865 2740028847 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

50

152

0.91

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

52

267

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8439 4 107
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.798 1 248
3qvm-assembly1.cif.gz_A the structure of olei00960, a hydrolase from oleispira antarctica 0.795 18 251
1ek1-assembly1.cif.gz_A crystal structure of murine soluble epoxide hydrolase complexed with ciu inhibitor 0.7921 2 251
5a62-assembly1.cif.gz_A-2 hydrolytic potential of the ammonia-oxidizing thaumarchaeon nitrososphaera gargenis - crystal structure and activity profiles of carboxylesterases linked to their metabolic function 0.7906 6 248
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9238 3 96 3.40.50.12270
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8867 3 96 3.40.50.12270
af_K7LW21_1_105_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8513 2 119 3.40.50.12270
af_K7LW21_1_105_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8286 2 119 3.40.50.12270
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8206 8 117 3.40.50.12270
ID Description Score Start End GO Terms
AF-A0A3D2LGI7-F1-model_v4 deleted 0.99 18 190
AF-Q2N9R6-F1-model_v4 Hydrolase 0.9889 2 248 GO:0016787
AF-A0A844XF21-F1-model_v4 Alpha/beta fold hydrolase 0.988 6 249 GO:0016787
AF-A0A4Q5T2Q7-F1-model_v4 Alpha/beta fold hydrolase 0.9831 4 173 GO:0016020
GO:0016787
AF-A0A495RT32-F1-model_v4 deleted 0.9802 2 250

Feature Viewer

pLDDT pTM Quality
95.86 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map