F263499

General Info

Members Datasets Scaffolds Average Seq Length
173 118 346 295

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0000178|Ga0500616_0000178_21990_22964
Length 324
Sequence MAAATSAPPAPSSASLVRRSTPAAGNSGAAPSRIVNAMTIDVEDYFHASALAPAAPMTRWDSLESRVVRNTDRLLELFADANVASTFFILGWVAERQPSLVRRIHAAGHEIASHGYFHQLAYDLEVAQFRQDVRKSKQLLEDLTGTRVDGYRAPSYSITRRSLWALDVLLDEGYTYDASIFPIRHDRYGIPDAPRHPYQLARQDGRQLIEAPPSTVRLGGANLPIAGGGYFRLLPYGWTRWGIGRVNRVEQRPVIFYLHPWEIDPGQPRLPVGRVSRLRHYRNLDRAEPRLQRLLRDFAFAPLDRVLRDAQPIDRSWTPEAISA

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
65 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
68 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
102 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
103 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
108 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
109 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
113 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
114 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
115 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
116 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
118 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.89
Nodule 0
Rhizoplane 2.89
Rhizosphere 91.91
Stem 0
Stem Tuber 0
Unclassified 6.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0000178 3300053153 Bacteria 106208
2 MRS1b_contig_6462006 2162886011 Bacteria 2222
3 rootL2_10339839 3300003322 Unclassified 1783
4 rootH1_10238756 3300003323 Bacteria 3169
5 Ga0065712_10067832 3300005290 Bacteria 27426
6 Ga0065715_10014218 3300005293 Bacteria 2460
7 Ga0065707_10000684 3300005295 Bacteria 14942
8 Ga0065707_10210441 3300005295 Bacteria 1251
9 Ga0070683_100000164 3300005329 Bacteria 43810
10 Ga0070670_100030261 3300005331 Bacteria 4662
11 Ga0068869_100026831 3300005334 Bacteria 4011
12 Ga0068869_100144013 3300005334 Bacteria 1843
13 Ga0070682_100084512 3300005337 Unclassified 2062
14 Ga0070689_100112224 3300005340 Bacteria 2170
15 Ga0070661_100100701 3300005344 Bacteria 2148
16 Ga0070668_100072810 3300005347 Bacteria 2678
17 Ga0070669_100074303 3300005353 Bacteria 2520
18 Ga0070675_100148824 3300005354 Bacteria 2006
19 Ga0070675_100396275 3300005354 Bacteria 1231
20 Ga0070674_100023401 3300005356 Bacteria 3998
21 Ga0070674_100138810 3300005356 Bacteria 1822
22 Ga0070688_100000629 3300005365 Bacteria 17601
23 Ga0070701_10043232 3300005438 Unclassified 2304
24 Ga0070700_100000016 3300005441 Bacteria 147213
25 Ga0070700_100069858 3300005441 Bacteria 2238
26 Ga0070685_10000116 3300005466 Bacteria 50879
27 Ga0070698_100117940 3300005471 Bacteria 2616
28 Ga0070684_100135645 3300005535 Bacteria 2223
29 Ga0070684_100538246 3300005535 Bacteria 1083
30 Ga0070696_100052090 3300005546 Bacteria 2847
31 Ga0070665_100347920 3300005548 Bacteria 1487
32 Ga0070704_100235803 3300005549 Bacteria 1495
33 Ga0070664_100086495 3300005564 Bacteria 2709
34 Ga0068859_100049864 3300005617 Bacteria 4205
35 Ga0068859_100512561 3300005617 Bacteria 1294
36 Ga0068870_10004286 3300005840 Bacteria 6137
37 Ga0068860_100000857 3300005843 Bacteria 33940
38 Ga0081539_10017272 3300005985 Bacteria 5077
39 Ga0075368_10018185 3300006042 Bacteria 2639
40 Ga0075368_10025064 3300006042 Bacteria 2288
41 Ga0075428_100023139 3300006844 Bacteria 6873
42 Ga0075430_100009634 3300006846 Bacteria 8164
43 Ga0075430_100168275 3300006846 Bacteria 1823
44 Ga0075431_100560518 3300006847 Bacteria 1129
45 Ga0075433_10003125 3300006852 Bacteria 12752
46 Ga0075433_10006610 3300006852 Bacteria 9179
47 Ga0075433_10031430 3300006852 Bacteria 4539
48 Ga0075434_100044832 3300006871 Bacteria 4387
49 Ga0075434_100233314 3300006871 Bacteria 1860
50 Ga0097620_100049864 3300006931 Bacteria 4205
51 Ga0097620_100512558 3300006931 Bacteria 1294
52 Ga0111539_10000793 3300009094 Bacteria 41143
53 Ga0111539_10005389 3300009094 Bacteria 16544
54 Ga0111539_10008978 3300009094 Bacteria 12656
55 Ga0111539_10074266 3300009094 Bacteria 4006
56 Ga0111539_10075543 3300009094 Bacteria 3969
57 Ga0111539_10080497 3300009094 Bacteria 3832
58 Ga0111539_10220698 3300009094 Unclassified 2208
59 Ga0111539_10444908 3300009094 Bacteria 1509
60 Ga0111539_10545178 3300009094 Bacteria 1351
61 Ga0114129_10006253 3300009147 Bacteria 16883
62 Ga0114129_10098085 3300009147 Bacteria 4056
63 Ga0114129_11077824 3300009147 Bacteria 1007
64 Ga0105248_10027968 3300009177 Bacteria 6279
65 Ga0105246_10085005 3300011119 Bacteria 2265
66 Ga0157375_10786794 3300013308 Bacteria 1101
67 Ga0157380_10006706 3300014326 Bacteria 8133
68 Ga0157380_10006844 3300014326 Bacteria 8059
69 Ga0157380_10069121 3300014326 Bacteria 2849
70 Ga0157380_10098089 3300014326 Unclassified 2434
71 Ga0157380_10179644 3300014326 Bacteria 1858
72 Ga0157377_10010774 3300014745 Bacteria 4537
73 Ga0157376_10245049 3300014969 Bacteria 1671
74 Ga0207697_10009441 3300025315 Bacteria 4214
75 Ga0207688_10015092 3300025901 Bacteria 4190
76 Ga0207643_10115843 3300025908 Bacteria 1583
77 Ga0207705_10366822 3300025909 Bacteria 1111
78 Ga0207649_10103743 3300025920 Bacteria 1887
79 Ga0207681_10104256 3300025923 Bacteria 2051
80 Ga0207659_10197500 3300025926 Bacteria 1604
81 Ga0207669_10094833 3300025937 Bacteria 1954
82 Ga0207711_10042766 3300025941 Bacteria 3860
83 Ga0207661_10008680 3300025944 Bacteria 7262
84 Ga0207679_10130274 3300025945 Bacteria 2017
85 Ga0207708_10000005 3300026075 Bacteria 284735
86 Ga0207648_10075439 3300026089 Bacteria 2939
87 Ga0207428_10010392 3300027907 Bacteria 8317
88 Ga0268266_10069471 3300028379 Bacteria 3052
89 Ga0268265_10050129 3300028380 Bacteria 3144
90 Ga0268264_10000036 3300028381 Bacteria 392994
91 Ga0265319_1004946 3300028563 Bacteria 6500
92 Ga0265319_1014886 3300028563 Bacteria 3034
93 Ga0265318_10000624 3300028577 Bacteria 24474
94 Ga0265338_10072736 3300028800 Bacteria 2934
95 Ga0265330_10004040 3300031235 Bacteria 7528
96 Ga0265332_10028979 3300031238 Bacteria 2421
97 Ga0265332_10109236 3300031238 Bacteria 1165
98 Ga0265320_10000562 3300031240 Bacteria 28641
99 Ga0265320_10001805 3300031240 Bacteria 15177
100 Ga0265329_10013022 3300031242 Bacteria 2975
101 Ga0265340_10018303 3300031247 Bacteria 3613
102 Ga0265331_10010782 3300031250 Bacteria 5029
103 Ga0265316_10016948 3300031344 Bacteria 6308
104 Ga0307513_10013770 3300031456 Bacteria 9918
105 Ga0307509_10001215 3300031507 Bacteria 43774
106 Ga0307408_100000043 3300031548 Bacteria 170358
107 Ga0307408_100056664 3300031548 Bacteria 2842
108 Ga0265313_10000086 3300031595 Bacteria 91279
109 Ga0265314_10002285 3300031711 Bacteria 19839
110 Ga0265314_10055955 3300031711 Bacteria 2718
111 Ga0265342_10005014 3300031712 Bacteria 10217
112 Ga0265342_10045236 3300031712 Bacteria 2650
113 Ga0307406_10000427 3300031901 Bacteria 24534
114 Ga0307406_10043523 3300031901 Bacteria 2809
115 Ga0307416_100015394 3300032002 Bacteria 5283
116 Ga0307411_10264064 3300032005 Unclassified 1361
117 Ga0373955_0083158 3300035172 Bacteria 1813
118 Ga0451807_2198211 3300041486 Bacteria 2460
119 Ga0453684_0022827 3300044712 Bacteria 9263
120 Ga0466967_0181986 3300045976 Bacteria 1983
121 Ga0495608_0147334 3300046511 Bacteria 1501
122 Ga0495680_0206893 3300047322 Bacteria 1406
123 Ga0496102_0291965 3300048905 Unclassified 1537
124 Ga0496109_0089187 3300048912 Bacteria 2851
125 Ga0496110_0270469 3300048913 Bacteria 1547
126 Ga0496113_0105197 3300048916 Bacteria 2191
127 Ga0501034_0119557 3300049571 Bacteria 2621
128 Ga0501039_0043932 3300049575 Bacteria 3452
129 Ga0501040_0072004 3300049576 Bacteria 2387
130 Ga0501043_0590073 3300049579 Unclassified 822
131 Ga0501046_0080943 3300049580 Bacteria 2509
132 Ga0501071_0111499 3300049587 Unclassified 2022
133 Ga0501071_0215264 3300049587 Bacteria 1445
134 Ga0501071_0272773 3300049587 Bacteria 1279
135 Ga0501072_0096094 3300049588 Bacteria 2355
136 Ga0501072_0426799 3300049588 Unclassified 1051
137 Ga0501073_0002958 3300049589 Bacteria 12742
138 Ga0501073_0009232 3300049589 Bacteria 7271
139 Ga0501075_0055359 3300049591 Bacteria 2985
140 Ga0501075_0173255 3300049591 Bacteria 1647
141 Ga0501076_0061252 3300049592 Bacteria 2995
142 Ga0501083_0068149 3300049744 Bacteria 2368
143 Ga0501045_0045965 3300049824 Bacteria 3179
144 nmdc:mga06z11_355254_c1 3300050494 Bacteria 878
145 nmdc:mga05p37_101420_c1 3300050507 Bacteria 3544
146 nmdc:mga05p37_111403_c1 3300050507 Bacteria 3366
147 nmdc:mga05p37_222004_c1 3300050507 Bacteria 2280
148 nmdc:mga05p37_237447_c1 3300050507 Bacteria 2193
149 nmdc:mga05p37_53_c1 3300050507 Bacteria 102685
150 nmdc:mga05p37_547713_c1 3300050507 Bacteria 1318
151 nmdc:mga0qj67_7118_c1 3300050509 Bacteria 8253
152 nmdc:mga0qj67_83219_c1 3300050509 Bacteria 2565
153 nmdc:mga06r32_144626_c1 3300050510 Unclassified 2355
154 nmdc:mga08y16_104132_c1 3300050511 Bacteria 2954
155 nmdc:mga08y16_276694_c1 3300050511 Bacteria 1732
156 nmdc:mga08y16_285_c1 3300050511 Bacteria 11438
157 nmdc:mga08y16_2973_c1 3300050511 Bacteria 17480
158 nmdc:mga0n895_183301_c1 3300050512 Bacteria 2125
159 nmdc:mga0n895_229596_c1 3300050512 Bacteria 1884
160 nmdc:mga0n895_9078_c1 3300050512 Bacteria 8673
161 nmdc:mga08x19_55988_c1 3300050514 Bacteria 2544
162 nmdc:mga0a205_2120_c1 3300050515 Bacteria 17403
163 nmdc:mga0a205_74276_c1 3300050515 Bacteria 3285
164 Ga0495601_0044877 3300053077 Bacteria 2778
165 Ga0495595_0016920 3300053084 Bacteria 3128
166 Ga0495619_0063834 3300053085 Bacteria 2454
167 Ga0500568_0002709 3300053139 Bacteria 10278
168 Ga0501082_0072981 3300060353 Bacteria 2956
169 Ga0501082_0192694 3300060353 Bacteria 1773
170 Ga0501082_0755182 3300060353 Bacteria 851
171 Ga0530510_0033912 3300061734 Bacteria 3676
172 Ga0530510_0078098 3300061734 Bacteria 2406
173 Ga0530510_0415186 3300061734 Unclassified 1015
174 Ga0500616_0000178
175 MRS1b_contig_6462006
176 rootL2_10339839
177 rootH1_10238756
178 Ga0065712_10067832
179 Ga0065715_10014218
180 Ga0065707_10000684
181 Ga0065707_10210441
182 Ga0070683_100000164
183 Ga0070670_100030261
184 Ga0068869_100026831
185 Ga0068869_100144013
186 Ga0070682_100084512
187 Ga0070689_100112224
188 Ga0070661_100100701
189 Ga0070668_100072810
190 Ga0070669_100074303
191 Ga0070675_100148824
192 Ga0070675_100396275
193 Ga0070674_100023401
194 Ga0070674_100138810
195 Ga0070688_100000629
196 Ga0070701_10043232
197 Ga0070700_100000016
198 Ga0070700_100069858
199 Ga0070685_10000116
200 Ga0070698_100117940
201 Ga0070684_100135645
202 Ga0070684_100538246
203 Ga0070696_100052090
204 Ga0070665_100347920
205 Ga0070704_100235803
206 Ga0070664_100086495
207 Ga0068859_100049864
208 Ga0068859_100512561
209 Ga0068870_10004286
210 Ga0068860_100000857
211 Ga0081539_10017272
212 Ga0075368_10018185
213 Ga0075368_10025064
214 Ga0075428_100023139
215 Ga0075430_100009634
216 Ga0075430_100168275
217 Ga0075431_100560518
218 Ga0075433_10003125
219 Ga0075433_10006610
220 Ga0075433_10031430
221 Ga0075434_100044832
222 Ga0075434_100233314
223 Ga0097620_100049864
224 Ga0097620_100512558
225 Ga0111539_10000793
226 Ga0111539_10005389
227 Ga0111539_10008978
228 Ga0111539_10074266
229 Ga0111539_10075543
230 Ga0111539_10080497
231 Ga0111539_10220698
232 Ga0111539_10444908
233 Ga0111539_10545178
234 Ga0114129_10006253
235 Ga0114129_10098085
236 Ga0114129_11077824
237 Ga0105248_10027968
238 Ga0105246_10085005
239 Ga0157375_10786794
240 Ga0157380_10006706
241 Ga0157380_10006844
242 Ga0157380_10069121
243 Ga0157380_10098089
244 Ga0157380_10179644
245 Ga0157377_10010774
246 Ga0157376_10245049
247 Ga0207697_10009441
248 Ga0207688_10015092
249 Ga0207643_10115843
250 Ga0207705_10366822
251 Ga0207649_10103743
252 Ga0207681_10104256
253 Ga0207659_10197500
254 Ga0207669_10094833
255 Ga0207711_10042766
256 Ga0207661_10008680
257 Ga0207679_10130274
258 Ga0207708_10000005
259 Ga0207648_10075439
260 Ga0207428_10010392
261 Ga0268266_10069471
262 Ga0268265_10050129
263 Ga0268264_10000036
264 Ga0265319_1004946
265 Ga0265319_1014886
266 Ga0265318_10000624
267 Ga0265338_10072736
268 Ga0265330_10004040
269 Ga0265332_10028979
270 Ga0265332_10109236
271 Ga0265320_10000562
272 Ga0265320_10001805
273 Ga0265329_10013022
274 Ga0265340_10018303
275 Ga0265331_10010782
276 Ga0265316_10016948
277 Ga0307513_10013770
278 Ga0307509_10001215
279 Ga0307408_100000043
280 Ga0307408_100056664
281 Ga0265313_10000086
282 Ga0265314_10002285
283 Ga0265314_10055955
284 Ga0265342_10005014
285 Ga0265342_10045236
286 Ga0307406_10000427
287 Ga0307406_10043523
288 Ga0307416_100015394
289 Ga0307411_10264064
290 Ga0373955_0083158
291 Ga0451807_2198211
292 Ga0453684_0022827
293 Ga0466967_0181986
294 Ga0495608_0147334
295 Ga0495680_0206893
296 Ga0496102_0291965
297 Ga0496109_0089187
298 Ga0496110_0270469
299 Ga0496113_0105197
300 Ga0501034_0119557
301 Ga0501039_0043932
302 Ga0501040_0072004
303 Ga0501043_0590073
304 Ga0501046_0080943
305 Ga0501071_0111499
306 Ga0501071_0215264
307 Ga0501071_0272773
308 Ga0501072_0096094
309 Ga0501072_0426799
310 Ga0501073_0002958
311 Ga0501073_0009232
312 Ga0501075_0055359
313 Ga0501075_0173255
314 Ga0501076_0061252
315 Ga0501083_0068149
316 Ga0501045_0045965
317 nmdc:mga06z11_355254_c1
318 nmdc:mga05p37_101420_c1
319 nmdc:mga05p37_111403_c1
320 nmdc:mga05p37_222004_c1
321 nmdc:mga05p37_237447_c1
322 nmdc:mga05p37_53_c1
323 nmdc:mga05p37_547713_c1
324 nmdc:mga0qj67_7118_c1
325 nmdc:mga0qj67_83219_c1
326 nmdc:mga06r32_144626_c1
327 nmdc:mga08y16_104132_c1
328 nmdc:mga08y16_276694_c1
329 nmdc:mga08y16_285_c1
330 nmdc:mga08y16_2973_c1
331 nmdc:mga0n895_183301_c1
332 nmdc:mga0n895_229596_c1
333 nmdc:mga0n895_9078_c1
334 nmdc:mga08x19_55988_c1
335 nmdc:mga0a205_2120_c1
336 nmdc:mga0a205_74276_c1
337 Ga0495601_0044877
338 Ga0495595_0016920
339 Ga0495619_0063834
340 Ga0500568_0002709
341 Ga0501082_0072981
342 Ga0501082_0192694
343 Ga0501082_0755182
344 Ga0530510_0033912
345 Ga0530510_0078098
346 Ga0530510_0415186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11959

DUF3473

Domain of unknown function (DUF3473)

178

308

0.97

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

59

176

0.93

PF10096

DUF2334

Uncharacterized protein conserved in bacteria (DUF2334)

93

297

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cc0-assembly1.cif.gz_B family 4 carbohydrate esterase from streptomyces lividans in complex with acetate 0.7936 9 278
6hpa-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme 0.7702 9 283
2j13-assembly1.cif.gz_A structure of a family 4 carbohydrate esterase from bacillus anthracis 0.7613 10 284
7bly-assembly1.cif.gz_A structure of the chitin deacetylase angcda from aspergillus niger 0.7558 9 284
2c1g-assembly1.cif.gz_A structure of streptococcus pneumoniae peptidoglycan deacetylase (sppgda) 0.7553 8 286
ID Description Score Start End Superfamily
2cc0B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7936 9 278 3.20.20.370
2j13A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7613 10 284 3.20.20.370
2c1iA03 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7563 12 286 3.20.20.370
af_Q06702_109_291_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7451 14 281 3.20.20.370
2c79A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7422 12 287 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A351A2E7-F1-model_v4 Polysaccharide deacetylase family protein 0.9816 9 131 GO:0005975
GO:0016810
AF-A0A1H4B8Y3-F1-model_v4 Polysaccharide deacetylase family protein, PEP-CTERM locus subfamily 0.9807 9 284 GO:0005975
GO:0016810
AF-G2E612-F1-model_v4 Polysaccharide deactylase family protein, PEP-CTERM locus subfamily 0.9798 9 285 GO:0005975
GO:0016810
AF-A0A836Q766-F1-model_v4 DUF3473 domain-containing protein 0.9786 73 288 GO:0005975
GO:0016810
AF-A0A7V4XDE7-F1-model_v4 Polysaccharide deacetylase family protein 0.9783 9 167 GO:0005975
GO:0016810

Map