F263232

General Info

Members Datasets Scaffolds Average Seq Length
173 132 170 257

Family's Representative Sequence

Representative Sequence 3300046528|Ga0495642_0003643|Ga0495642_0003643_3952_4794
Length 280
Sequence MHQRQLMYMQDMTTQQLRPDVAPPEFLQLAGHPLRWRLLSELARSDRLVHELTGLVGEAQNLVSYHLGKLRDGRLVSARRSSADRRDTYYGLDLARVGRLLSAAGGALHPGLRLTAPSRAAAPTAPVRVLFLCSGNSARSPMAEALARARSGGAIEAYSAGSHPKLVHPNAVRVMRDEYGLDLTGHESRRLDVFAGQRFDWVISLCDRVREVCPEFPGHPEVIHWSIANPATGETDDVTYPLFQQTAAELATRVDFLLAALSDQTPAPGSAQEAQDGEVP

Samples

Sample ID Description Type Environment
1 2643221615 Nocardioides sp. Root224 Isolate Unclassified
2 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
3 2687453737 Frankia sp. BMG5.36 Isolate Nodule
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
92 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
98 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
99 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
105 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
131 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0.58
Rhizoplane 5.2
Rhizosphere 87.28
Stem 0
Stem Tuber 0
Unclassified 5.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100143172 3300005329 Bacteria 2265
2 Ga0070670_100010452 3300005331 Bacteria 7921
3 Ga0070670_100210698 3300005331 Bacteria 1690
4 Ga0070668_100003407 3300005347 Bacteria 11738
5 Ga0070671_100125908 3300005355 Bacteria 2157
6 Ga0070673_100140608 3300005364 Bacteria 2036
7 Ga0070659_100183954 3300005366 Bacteria 1715
8 Ga0070667_100006285 3300005367 Bacteria 9873
9 Ga0070708_100685779 3300005445 Bacteria 965
10 Ga0070678_100304343 3300005456 Bacteria 1356
11 Ga0070681_10018926 3300005458 Bacteria 6891
12 Ga0070681_10118844 3300005458 Bacteria 2579
13 Ga0070707_100271537 3300005468 Bacteria 1649
14 Ga0070679_100020575 3300005530 Bacteria 6435
15 Ga0070679_100670831 3300005530 Unclassified 979
16 Ga0070684_100288304 3300005535 Bacteria 1505
17 Ga0068853_100119242 3300005539 Bacteria 2351
18 Ga0070665_100000921 3300005548 Bacteria 37702
19 Ga0068855_100033296 3300005563 Bacteria 6152
20 Ga0068855_100049673 3300005563 Bacteria 4946
21 Ga0068855_100151240 3300005563 Bacteria 2639
22 Ga0068855_100522963 3300005563 Bacteria 1287
23 Ga0070664_100099451 3300005564 Bacteria 2528
24 Ga0068857_100123033 3300005577 Bacteria 2337
25 Ga0068852_100487758 3300005616 Bacteria 1225
26 Ga0068859_100192226 3300005617 Bacteria 2125
27 Ga0068864_100062768 3300005618 Bacteria 3219
28 Ga0068864_100175693 3300005618 Bacteria 1955
29 Ga0068861_100077643 3300005719 Bacteria 2591
30 Ga0068863_100305864 3300005841 Bacteria 1543
31 Ga0068860_100000051 3300005843 Bacteria 208179
32 Ga0068860_100040473 3300005843 Bacteria 4453
33 Ga0068862_100009989 3300005844 Bacteria 7842
34 Ga0068862_100016156 3300005844 Bacteria 6209
35 Ga0068862_100885981 3300005844 Unclassified 876
36 Ga0081455_10127861 3300005937 Bacteria 1991
37 Ga0081538_10000691 3300005981 Bacteria 37035
38 Ga0081538_10001965 3300005981 Bacteria 20589
39 Ga0081538_10063331 3300005981 Bacteria 2100
40 Ga0070712_100019455 3300006175 Bacteria 4429
41 Ga0068865_100000361 3300006881 Bacteria 25141
42 Ga0097620_100192207 3300006931 Bacteria 2125
43 Ga0105240_10016966 3300009093 Bacteria 9838
44 Ga0105240_10228049 3300009093 Bacteria 2166
45 Ga0105240_10615166 3300009093 Bacteria 1195
46 Ga0105248_10000782 3300009177 Bacteria 35721
47 Ga0105248_10127550 3300009177 Bacteria 2870
48 Ga0105237_10189792 3300009545 Bacteria 2055
49 Ga0105238_10026932 3300009551 Bacteria 5860
50 Ga0105238_10045424 3300009551 Bacteria 4437
51 Ga0105238_10048588 3300009551 Bacteria 4275
52 Ga0105238_10243504 3300009551 Bacteria 1776
53 Ga0105249_10054706 3300009553 Bacteria 3650
54 Ga0105239_10160078 3300010375 Bacteria 2515
55 Ga0105239_10377353 3300010375 Bacteria 1603
56 Ga0105239_10395162 3300010375 Bacteria 1564
57 Ga0157369_10005395 3300013105 Bacteria 14884
58 Ga0157369_10462363 3300013105 Bacteria 1314
59 Ga0157372_10716167 3300013307 Bacteria 1164
60 Ga0157375_10026412 3300013308 Bacteria 5411
61 Ga0163163_10143770 3300014325 Bacteria 2428
62 Ga0163163_10840327 3300014325 Bacteria 982
63 Ga0209026_1003744 3300025250 Bacteria 4827
64 Ga0207699_10049765 3300025906 Bacteria 2468
65 Ga0207705_10068130 3300025909 Bacteria 2576
66 Ga0207705_10260272 3300025909 Bacteria 1325
67 Ga0207707_10142636 3300025912 Bacteria 2094
68 Ga0207707_10276024 3300025912 Bacteria 1456
69 Ga0207695_10027506 3300025913 Bacteria 6331
70 Ga0207693_10161386 3300025915 Bacteria 1763
71 Ga0207660_10011632 3300025917 Bacteria 5738
72 Ga0207657_10013587 3300025919 Bacteria 7985
73 Ga0207657_10052367 3300025919 Bacteria 3542
74 Ga0207652_10249019 3300025921 Bacteria 1602
75 Ga0207646_10253459 3300025922 Bacteria 1590
76 Ga0207694_10024776 3300025924 Bacteria 4558
77 Ga0207694_10045411 3300025924 Bacteria 3394
78 Ga0207694_10338276 3300025924 Bacteria 1244
79 Ga0207690_10325860 3300025932 Unclassified 1208
80 Ga0207706_10030213 3300025933 Bacteria 4835
81 Ga0207704_10007298 3300025938 Bacteria 5214
82 Ga0207711_10000302 3300025941 Bacteria 52984
83 Ga0207711_10645799 3300025941 Bacteria 987
84 Ga0207661_10605396 3300025944 Bacteria 1006
85 Ga0207667_10060483 3300025949 Bacteria 3964
86 Ga0207667_10070219 3300025949 Bacteria 3646
87 Ga0207667_10164360 3300025949 Bacteria 2282
88 Ga0207667_10417592 3300025949 Bacteria 1365
89 Ga0207668_10011417 3300025972 Bacteria 5396
90 Ga0207668_10072202 3300025972 Bacteria 2468
91 Ga0207658_10296440 3300025986 Bacteria 1391
92 Ga0207639_10159947 3300026041 Bacteria 1897
93 Ga0207639_10188171 3300026041 Bacteria 1761
94 Ga0207641_10110146 3300026088 Bacteria 2440
95 Ga0207676_10209743 3300026095 Bacteria 1727
96 Ga0207676_10339475 3300026095 Bacteria 1385
97 Ga0207675_100046422 3300026118 Bacteria 4058
98 Ga0268266_10000003 3300028379 Bacteria 1701703
99 Ga0268265_10017175 3300028380 Bacteria 4987
100 Ga0268265_10098768 3300028380 Bacteria 2352
101 Ga0268264_10000021 3300028381 Bacteria 481580
102 Ga0268264_10280114 3300028381 Bacteria 1561
103 Ga0307511_10059333 3300030521 Bacteria 2944
104 Ga0265325_10004200 3300031241 Bacteria 9150
105 Ga0265339_10014044 3300031249 Bacteria 4837
106 Ga0265327_10000275 3300031251 Bacteria 101668
107 Ga0265316_10015415 3300031344 Bacteria 6684
108 Ga0265342_10099577 3300031712 Bacteria 1658
109 Ga0307516_10000001 3300031730 Bacteria 510338
110 Ga0307405_10492112 3300031731 Bacteria 981
111 Ga0307413_10315981 3300031824 Bacteria 1191
112 Ga0307406_10082497 3300031901 Bacteria 2141
113 Ga0307406_10084754 3300031901 Bacteria 2117
114 Ga0307416_100120549 3300032002 Bacteria 2336
115 Ga0307415_100685984 3300032126 Bacteria 922
116 Ga0373936_0009520 3300035113 Bacteria 3662
117 Ga0373933_0221488 3300035724 Bacteria 1214
118 Ga0373937_0239102 3300036401 Bacteria 1711
119 Ga0395899_0000083 3300037312 Bacteria 161878
120 Ga0395900_0000004 3300037418 Bacteria 564908
121 Ga0395898_0019481 3300037466 Bacteria 6904
122 Ga0395905_0175890 3300037471 Bacteria 2010
123 Ga0395905_0295168 3300037471 Bacteria 1508
124 Ga0395901_0000005 3300038443 Bacteria 544998
125 Ga0436365_1106406 3300039437 Bacteria 17151
126 Ga0451791_1873520 3300041451 Bacteria 2311
127 Ga0451837_1839495 3300041494 Bacteria 1072
128 Ga0495592_0215112 3300046454 Bacteria 1288
129 Ga0495639_0200661 3300046475 Bacteria 976
130 Ga0495664_0114967 3300046477 Bacteria 1626
131 Ga0495628_0232784 3300046516 Bacteria 1380
132 Ga0495642_0003643 3300046528 Bacteria 6050
133 Ga0495586_0158476 3300046535 Bacteria 1276
134 Ga0495645_0023142 3300046543 Bacteria 4498
135 Ga0495668_0050623 3300046616 Bacteria 2302
136 Ga0495668_0051733 3300046616 Bacteria 2274
137 Ga0495634_0215403 3300046642 Bacteria 1187
138 Ga0495599_0148817 3300046678 Bacteria 1451
139 Ga0495613_0185832 3300046689 Bacteria 1470
140 Ga0495670_0136929 3300046691 Bacteria 1279
141 Ga0495636_0086524 3300047318 Bacteria 1356
142 Ga0495684_0230167 3300047471 Bacteria 1356
143 Ga0496101_0456392 3300048904 Bacteria 1008
144 Ga0496102_0119668 3300048905 Bacteria 2459
145 Ga0496108_0145568 3300048911 Bacteria 2043
146 Ga0496108_0172947 3300048911 Bacteria 1869
147 Ga0496109_0501868 3300048912 Bacteria 1145
148 Ga0496112_0130959 3300048915 Bacteria 2479
149 Ga0496113_0357662 3300048916 Bacteria 1171
150 Ga0496115_0022278 3300048918 Bacteria 4907
151 Ga0496116_0006556 3300048919 Bacteria 10540
152 Ga0496118_0005532 3300048921 Bacteria 14336
153 Ga0496119_0000763 3300048922 Bacteria 43180
154 Ga0501032_0199614 3300049569 Bacteria 1305
155 Ga0501033_0065870 3300049570 Bacteria 2664
156 Ga0501036_0005580 3300049572 Bacteria 10204
157 Ga0501038_0002656 3300049574 Bacteria 16704
158 Ga0501043_0061240 3300049579 Bacteria 2955
159 Ga0501046_0171387 3300049580 Bacteria 1628
160 Ga0501067_0192374 3300049583 Bacteria 1136
161 Ga0501069_0140677 3300049585 Bacteria 1384
162 Ga0501073_0013838 3300049589 Bacteria 5866
163 Ga0501074_0010439 3300049590 Bacteria 6740
164 Ga0501035_0028642 3300049822 Bacteria 5084
165 Ga0495595_0040631 3300053084 Bacteria 2126
166 Ga0495619_0033796 3300053085 Bacteria 3322
167 Ga0495619_0203692 3300053085 Bacteria 1370
168 Ga0500556_0000567 3300053104 Bacteria 24565
169 Ga0500593_000133 3300053117 Bacteria 29664
170 Ga0501082_0027248 3300060353 Bacteria 4920

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_10840327 Ga0163163_108403272 216
2 3300005331 Ga0070670_100210698 Ga0070670_1002106981 230
3 3300009553 Ga0105249_10054706 Ga0105249_100547061 230
4 3300025944 Ga0207661_10605396 Ga0207661_106053962 230
5 3300041451 Ga0451791_1873520 Ga0451791_1873520_1084_1785 231
6 3300041494 Ga0451837_1839495 Ga0451837_1839495_137_838 231
7 3300048905 Ga0496102_0119668 Ga0496102_0119668_216_947 233
8 3300048919 Ga0496116_0006556 Ga0496116_0006556_6142_6873 233
9 3300048921 Ga0496118_0005532 Ga0496118_0005532_3618_4349 233
10 3300048922 Ga0496119_0000763 Ga0496119_0000763_40793_41524 233
11 3300006175 Ga0070712_100019455 Ga0070712_1000194552 235
12 3300025906 Ga0207699_10049765 Ga0207699_100497653 235
13 3300025915 Ga0207693_10161386 Ga0207693_101613862 235
14 3300049570 Ga0501033_0065870 Ga0501033_0065870_1553_2326 238
15 3300049579 Ga0501043_0061240 Ga0501043_0061240_176_949 238
16 3300049580 Ga0501046_0171387 Ga0501046_0171387_377_1150 238
17 3300049589 Ga0501073_0013838 Ga0501073_0013838_2537_3310 238
18 3300049822 Ga0501035_0028642 Ga0501035_0028642_2485_3258 238
19 iso_pu_bacteria 2687453737 2689957204 238
20 3300005937 Ga0081455_10127861 Ga0081455_101278613 239
21 3300031901 Ga0307406_10082497 Ga0307406_100824971 239
22 3300032002 Ga0307416_100120549 Ga0307416_1001205492 239
23 3300032126 Ga0307415_100685984 Ga0307415_1006859841 239
24 3300049569 Ga0501032_0199614 Ga0501032_0199614_177_950 239
25 3300049572 Ga0501036_0005580 Ga0501036_0005580_2229_3005 239
26 3300049574 Ga0501038_0002656 Ga0501038_0002656_7366_8142 239
27 3300049585 Ga0501069_0140677 Ga0501069_0140677_594_1370 239
28 3300049590 Ga0501074_0010439 Ga0501074_0010439_714_1490 239
29 3300060353 Ga0501082_0027248 Ga0501082_0027248_2597_3373 239
30 3300031824 Ga0307413_10315981 Ga0307413_103159812 240
31 3300049583 Ga0501067_0192374 Ga0501067_0192374_64_840 240
32 3300005981 Ga0081538_10001965 Ga0081538_1000196516 241
33 3300046477 Ga0495664_0114967 Ga0495664_0114967_370_1113 243
34 3300005445 Ga0070708_100685779 Ga0070708_1006857791 246
35 3300005468 Ga0070707_100271537 Ga0070707_1002715373 246
36 3300010375 Ga0105239_10377353 Ga0105239_103773531 246
37 3300025922 Ga0207646_10253459 Ga0207646_102534591 246
38 3300031731 Ga0307405_10492112 Ga0307405_104921121 246
39 3300025941 Ga0207711_10000302 Ga0207711_1000030213 247
40 3300053085 Ga0495619_0203692 Ga0495619_0203692_510_1298 249
41 3300005535 Ga0070684_100288304 Ga0070684_1002883042 250
42 3300046642 Ga0495634_0215403 Ga0495634_0215403_153_950 250
43 3300047471 Ga0495684_0230167 Ga0495684_0230167_447_1244 250
44 3300025250 Ga0209026_1003744 Ga0209026_10037443 251
45 3300005355 Ga0070671_100125908 Ga0070671_1001259082 252
46 3300005364 Ga0070673_100140608 Ga0070673_1001406082 252
47 3300005456 Ga0070678_100304343 Ga0070678_1003043432 252
48 3300005564 Ga0070664_100099451 Ga0070664_1000994514 252
49 3300005618 Ga0068864_100062768 Ga0068864_1000627682 252
50 3300005841 Ga0068863_100305864 Ga0068863_1003058641 252
51 3300009177 Ga0105248_10127550 Ga0105248_101275503 252
52 3300013308 Ga0157375_10026412 Ga0157375_100264127 252
53 3300025933 Ga0207706_10030213 Ga0207706_100302134 252
54 3300025941 Ga0207711_10645799 Ga0207711_106457991 252
55 3300026095 Ga0207676_10209743 Ga0207676_102097432 252
56 3300031901 Ga0307406_10084754 Ga0307406_100847543 252
57 3300037312 Ga0395899_0000083 Ga0395899_0000083_28679_29461 252
58 3300037418 Ga0395900_0000004 Ga0395900_0000004_132181_132963 252
59 3300037466 Ga0395898_0019481 Ga0395898_0019481_1708_2490 252
60 3300038443 Ga0395901_0000005 Ga0395901_0000005_432603_433385 252
61 3300048911 Ga0496108_0172947 Ga0496108_0172947_474_1253 252
62 3300048912 Ga0496109_0501868 Ga0496109_0501868_91_870 252
63 3300048916 Ga0496113_0357662 Ga0496113_0357662_24_803 252
64 3300053117 Ga0500593_000133 Ga0500593_000133_15872_16660 252
65 3300009551 Ga0105238_10026932 Ga0105238_100269323 253
66 3300010375 Ga0105239_10395162 Ga0105239_103951622 253
67 3300025924 Ga0207694_10024776 Ga0207694_100247762 253
68 3300036401 Ga0373937_0239102 Ga0373937_0239102_133_930 253
69 3300037471 Ga0395905_0295168 Ga0395905_0295168_287_1057 253
70 3300046689 Ga0495613_0185832 Ga0495613_0185832_608_1393 253
71 3300048915 Ga0496112_0130959 Ga0496112_0130959_1659_2432 253
72 3300053104 Ga0500556_0000567 Ga0500556_0000567_11197_12021 253
73 3300005548 Ga0070665_100000921 Ga0070665_10000092132 254
74 3300005844 Ga0068862_100016156 Ga0068862_1000161564 254
75 3300005844 Ga0068862_100885981 Ga0068862_1008859812 254
76 3300005981 Ga0081538_10000691 Ga0081538_1000069123 254
77 3300005981 Ga0081538_10063331 Ga0081538_100633311 254
78 3300025919 Ga0207657_10052367 Ga0207657_100523673 254
79 3300025924 Ga0207694_10045411 Ga0207694_100454112 254
80 3300025924 Ga0207694_10338276 Ga0207694_103382762 254
81 3300025972 Ga0207668_10072202 Ga0207668_100722023 254
82 3300028379 Ga0268266_10000003 Ga0268266_10000003250 254
83 3300028380 Ga0268265_10017175 Ga0268265_100171754 254
84 3300031730 Ga0307516_10000001 Ga0307516_10000001488 254
85 3300035724 Ga0373933_0221488 Ga0373933_0221488_277_1056 254
86 3300037471 Ga0395905_0175890 Ga0395905_0175890_1025_1798 254
87 3300039437 Ga0436365_1106406 Ga0436365_1106406_14574_15362 254
88 3300046475 Ga0495639_0200661 Ga0495639_0200661_112_891 254
89 3300046616 Ga0495668_0050623 Ga0495668_0050623_192_995 254
90 3300047318 Ga0495636_0086524 Ga0495636_0086524_135_911 254
91 3300048911 Ga0496108_0145568 Ga0496108_0145568_631_1407 254
92 3300048918 Ga0496115_0022278 Ga0496115_0022278_1986_2801 254
93 3300053084 Ga0495595_0040631 Ga0495595_0040631_1051_1827 254
94 3300053085 Ga0495619_0033796 Ga0495619_0033796_2203_2979 254
95 3300005329 Ga0070683_100143172 Ga0070683_1001431722 255
96 3300005331 Ga0070670_100010452 Ga0070670_1000104524 255
97 3300005347 Ga0070668_100003407 Ga0070668_1000034079 255
98 3300005366 Ga0070659_100183954 Ga0070659_1001839541 255
99 3300005367 Ga0070667_100006285 Ga0070667_1000062853 255
100 3300005458 Ga0070681_10018926 Ga0070681_100189264 255
101 3300005458 Ga0070681_10118844 Ga0070681_101188441 255
102 3300005530 Ga0070679_100020575 Ga0070679_1000205753 255
103 3300005530 Ga0070679_100670831 Ga0070679_1006708311 255
104 3300005539 Ga0068853_100119242 Ga0068853_1001192422 255
105 3300005563 Ga0068855_100033296 Ga0068855_1000332963 255
106 3300005563 Ga0068855_100049673 Ga0068855_1000496735 255
107 3300005563 Ga0068855_100151240 Ga0068855_1001512404 255
108 3300005563 Ga0068855_100522963 Ga0068855_1005229632 255
109 3300005577 Ga0068857_100123033 Ga0068857_1001230333 255
110 3300005616 Ga0068852_100487758 Ga0068852_1004877582 255
111 3300005617 Ga0068859_100192226 Ga0068859_1001922263 255
112 3300005618 Ga0068864_100175693 Ga0068864_1001756932 255
113 3300005719 Ga0068861_100077643 Ga0068861_1000776433 255
114 3300005843 Ga0068860_100000051 Ga0068860_100000051116 255
115 3300005843 Ga0068860_100040473 Ga0068860_1000404732 255
116 3300005844 Ga0068862_100009989 Ga0068862_1000099894 255
117 3300006881 Ga0068865_100000361 Ga0068865_10000036128 255
118 3300006931 Ga0097620_100192207 Ga0097620_1001922073 255
119 3300009093 Ga0105240_10016966 Ga0105240_1001696612 255
120 3300009093 Ga0105240_10228049 Ga0105240_102280492 255
121 3300009093 Ga0105240_10615166 Ga0105240_106151661 255
122 3300009177 Ga0105248_10000782 Ga0105248_1000078214 255
123 3300009545 Ga0105237_10189792 Ga0105237_101897923 255
124 3300009551 Ga0105238_10045424 Ga0105238_100454242 255
125 3300009551 Ga0105238_10048588 Ga0105238_100485883 255
126 3300009551 Ga0105238_10243504 Ga0105238_102435043 255
127 3300010375 Ga0105239_10160078 Ga0105239_101600781 255
128 3300013105 Ga0157369_10005395 Ga0157369_1000539512 255
129 3300013105 Ga0157369_10462363 Ga0157369_104623632 255
130 3300013307 Ga0157372_10716167 Ga0157372_107161671 255
131 3300014325 Ga0163163_10143770 Ga0163163_101437704 255
132 3300025909 Ga0207705_10068130 Ga0207705_100681302 255
133 3300025909 Ga0207705_10260272 Ga0207705_102602721 255
134 3300025912 Ga0207707_10142636 Ga0207707_101426362 255
135 3300025912 Ga0207707_10276024 Ga0207707_102760242 255
136 3300025913 Ga0207695_10027506 Ga0207695_100275065 255
137 3300025917 Ga0207660_10011632 Ga0207660_100116327 255
138 3300025919 Ga0207657_10013587 Ga0207657_100135875 255
139 3300025921 Ga0207652_10249019 Ga0207652_102490192 255
140 3300025932 Ga0207690_10325860 Ga0207690_103258602 255
141 3300025938 Ga0207704_10007298 Ga0207704_100072986 255
142 3300025949 Ga0207667_10060483 Ga0207667_100604833 255
143 3300025949 Ga0207667_10070219 Ga0207667_100702193 255
144 3300025949 Ga0207667_10164360 Ga0207667_101643602 255
145 3300025949 Ga0207667_10417592 Ga0207667_104175922 255
146 3300025972 Ga0207668_10011417 Ga0207668_100114172 255
147 3300025986 Ga0207658_10296440 Ga0207658_102964401 255
148 3300026041 Ga0207639_10159947 Ga0207639_101599471 255
149 3300026041 Ga0207639_10188171 Ga0207639_101881712 255
150 3300026088 Ga0207641_10110146 Ga0207641_101101463 255
151 3300026095 Ga0207676_10339475 Ga0207676_103394752 255
152 3300026118 Ga0207675_100046422 Ga0207675_1000464222 255
153 3300028380 Ga0268265_10098768 Ga0268265_100987682 255
154 3300028381 Ga0268264_10000021 Ga0268264_10000021325 255
155 3300028381 Ga0268264_10280114 Ga0268264_102801141 255
156 3300030521 Ga0307511_10059333 Ga0307511_100593336 255
157 3300031241 Ga0265325_10004200 Ga0265325_1000420015 255
158 3300031249 Ga0265339_10014044 Ga0265339_100140447 255
159 3300031251 Ga0265327_10000275 Ga0265327_1000027592 255
160 3300031344 Ga0265316_10015415 Ga0265316_100154152 255
161 3300031712 Ga0265342_10099577 Ga0265342_100995772 255
162 3300035113 Ga0373936_0009520 Ga0373936_0009520_2703_3497 255
163 3300046454 Ga0495592_0215112 Ga0495592_0215112_221_1015 255
164 3300046516 Ga0495628_0232784 Ga0495628_0232784_277_1071 255
165 3300046528 Ga0495642_0003643 Ga0495642_0003643_3952_4794 255
166 3300046535 Ga0495586_0158476 Ga0495586_0158476_217_1011 255
167 3300046543 Ga0495645_0023142 Ga0495645_0023142_2231_3025 255
168 3300046616 Ga0495668_0051733 Ga0495668_0051733_147_953 255
169 3300046678 Ga0495599_0148817 Ga0495599_0148817_517_1311 255
170 3300046691 Ga0495670_0136929 Ga0495670_0136929_375_1187 255
171 3300048904 Ga0496101_0456392 Ga0496101_0456392_13_798 255
172 iso_pu_bacteria 2643221615 2644091944 255
173 iso_pu_bacteria 2643221657 2644321747 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

32

78

0.96

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

129

258

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9483 112 245
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.939 112 246
6o8o-assembly2.cif.gz_D crystal structure of c9s disulfide state of sulfide-responsive transcriptional repressor (sqrr) from rhodobacter capsulatus. 0.938 14 85
1rxi-assembly1.cif.gz_A pi258 arsenate reductase (arsc) triple mutant c10s/c15a/c82s 0.928 111 243
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9274 112 245
ID Description Score Start End Superfamily
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9551 35 79 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.955 20 79 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9545 20 85 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9311 16 80 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9295 26 81 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7J9VFI2-F1-model_v4 ArsR family transcriptional regulator 0.9682 10 250 GO:0003700
GO:0046685
AF-A0A2G9YLL4-F1-model_v4 Protein-tyrosine-phosphatase 0.963 112 246 GO:0046685
AF-A0A524LTQ5-F1-model_v4 Arsenate reductase ArsC 0.961 113 240 GO:0046685
AF-E1IAS5-F1-model_v4 Protein tyrosine phosphatase 0.9603 15 250 GO:0003700
GO:0046685
AF-A0A2S8FER2-F1-model_v4 Low molecular weight phosphatase family protein 0.96 113 245 GO:0046685

Feature Viewer

pLDDT pTM Quality
89.71 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map