F262781

General Info

Members Datasets Scaffolds Average Seq Length
173 128 346 378

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10000006|Ga0207687_10000006445
Length 453
Sequence VRKADERVMLDDDEALAGVFVDDFFDLDRRFFDGRRLYCIVSNNRNFFFRFICVHLRHLRIRFYPQITQMEADKLPCGRMRILVLGAGRMGYGAVHDLVNQPDVEETTVADVAAERAHHVASSVEGNVTPQAIDVSRHQDVVELMRGHDSAISCVNYWLNERLARAAIEAGTNFCDLGGNNDVVDAELALDAEAKKRGINIIPDCGLAPGMVAVLVAHGAAKFEKLDEIHIRVGGLPLDPKPPLDYQLVFSVEGLINEYIERARVLRDGRIAFVDSMTEVEDLEFPEPFGKMEAFQTSGGTSTLPETFLGRVRELDYKTIRYPGHCAKFKTMIDLGLCSSETITVDGVQVAPRRVLGDLLVRNLPADEPDAVLVRVEFAGDGRRLRYDIVDRYDETTGLSAMMRTTAFPASIVALMMARGQTTQKGALPQERCIPPELFMTELAKRKIVVNIS

Samples

Sample ID Description Type Environment
1 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
104 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
111 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
127 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
128 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 0.58
Rhizosphere 92.49
Stem 0
Stem Tuber 0
Unclassified 15.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207687_10000006 3300025927 Bacteria 641680
2 LJQas_1000052 3300000549 Bacteria 18545
3 rootL2_10226496 3300003322 Bacteria 2913
4 Ga0065715_10021978 3300005293 Bacteria 1698
5 Ga0065715_10109395 3300005293 Bacteria 2670
6 Ga0070670_100000131 3300005331 Bacteria 70778
7 Ga0070680_100005029 3300005336 Bacteria 9975
8 Ga0070682_100000001 3300005337 Bacteria 569837
9 Ga0068868_100001221 3300005338 Bacteria 17666
10 Ga0068868_100016653 3300005338 Bacteria 5465
11 Ga0070689_100012153 3300005340 Bacteria 6192
12 Ga0070692_10025714 3300005345 Unclassified 2904
13 Ga0070675_100000002 3300005354 Bacteria 435215
14 Ga0070709_10017277 3300005434 Bacteria 4136
15 Ga0070709_10024713 3300005434 Bacteria 3539
16 Ga0070714_100000069 3300005435 Bacteria 93567
17 Ga0070713_100154741 3300005436 Unclassified 2043
18 Ga0070701_10022554 3300005438 Unclassified 3019
19 Ga0070708_100084584 3300005445 Bacteria 2878
20 Ga0070681_10016605 3300005458 Bacteria 7351
21 Ga0070706_100014358 3300005467 Bacteria 7319
22 Ga0070706_100019016 3300005467 Bacteria 6336
23 Ga0070707_100003590 3300005468 Bacteria 14633
24 Ga0070698_100042595 3300005471 Bacteria 4657
25 Ga0070698_100271215 3300005471 Unclassified 1628
26 Ga0070699_100030413 3300005518 Bacteria 4661
27 Ga0070699_100063460 3300005518 Bacteria 3203
28 Ga0070699_100158287 3300005518 Bacteria 2004
29 Ga0070679_100034313 3300005530 Bacteria 5028
30 Ga0070684_100001071 3300005535 Bacteria 19605
31 Ga0070672_100022061 3300005543 Bacteria 4669
32 Ga0070695_100023982 3300005545 Bacteria 3755
33 Ga0070665_100084520 3300005548 Bacteria 3179
34 Ga0068857_100034902 3300005577 Bacteria 4450
35 Ga0068854_100011343 3300005578 Bacteria 5796
36 Ga0068854_100038435 3300005578 Bacteria 3366
37 Ga0070702_100042617 3300005615 Bacteria 2553
38 Ga0070702_100148199 3300005615 Bacteria 1503
39 Ga0068859_100018415 3300005617 Bacteria 7020
40 Ga0068864_100060629 3300005618 Unclassified 3275
41 Ga0068870_10090188 3300005840 Bacteria 1712
42 Ga0068863_100079324 3300005841 Unclassified 3109
43 Ga0068858_100034071 3300005842 Unclassified 4724
44 Ga0068860_100021234 3300005843 Bacteria 6288
45 Ga0070717_10000050 3300006028 Bacteria 103137
46 Ga0070716_100155901 3300006173 Bacteria 1474
47 Ga0097621_100006136 3300006237 Bacteria 8511
48 Ga0097621_100310959 3300006237 Unclassified 1394
49 Ga0068871_100101808 3300006358 Bacteria 2407
50 Ga0075431_100022939 3300006847 Bacteria 6380
51 Ga0075434_100126471 3300006871 Bacteria 2573
52 Ga0075436_100046540 3300006914 Bacteria 2992
53 Ga0097620_100018414 3300006931 Bacteria 7020
54 Ga0105244_10071625 3300009036 Unclassified 1728
55 Ga0105240_10025561 3300009093 Bacteria 7756
56 Ga0111539_10000018 3300009094 Bacteria 270743
57 Ga0111539_10103245 3300009094 Bacteria 3346
58 Ga0105245_10000027 3300009098 Bacteria 162116
59 Ga0105245_10000770 3300009098 Bacteria 29024
60 Ga0105245_10000817 3300009098 Bacteria 28373
61 Ga0105247_10095015 3300009101 Bacteria 1898
62 Ga0114129_10136904 3300009147 Bacteria 3360
63 Ga0114129_10332036 3300009147 Bacteria 2018
64 Ga0105242_10000937 3300009176 Bacteria 22733
65 Ga0105242_10048340 3300009176 Unclassified 3458
66 Ga0105237_10120986 3300009545 Bacteria 2612
67 Ga0105238_10000118 3300009551 Bacteria 86809
68 Ga0105249_10008120 3300009553 Bacteria 9152
69 Ga0105249_10031045 3300009553 Unclassified 4830
70 Ga0157369_10000123 3300013105 Bacteria 110823
71 Ga0157374_10000019 3300013296 Bacteria 280543
72 Ga0157378_10038526 3300013297 Bacteria 4237
73 Ga0157378_10167494 3300013297 Bacteria 2059
74 Ga0163162_10119583 3300013306 Unclassified 2737
75 Ga0157375_10000001 3300013308 Bacteria 696576
76 Ga0157375_10017041 3300013308 Bacteria 6546
77 Ga0157375_10036051 3300013308 Unclassified 4728
78 Ga0157375_10203411 3300013308 Bacteria 2136
79 Ga0157375_10278115 3300013308 Bacteria 1837
80 Ga0163163_10134014 3300014325 Bacteria 2518
81 Ga0157380_10000970 3300014326 Bacteria 18177
82 Ga0157380_10013273 3300014326 Bacteria 6002
83 Ga0157377_10000110 3300014745 Bacteria 56152
84 Ga0157377_10066363 3300014745 Bacteria 2074
85 Ga0157376_10000011 3300014969 Bacteria 307434
86 Ga0213873_10000002 3300021358 Bacteria 1164195
87 Ga0213876_10000001 3300021384 Bacteria 1186326
88 Ga0213876_10000060 3300021384 Bacteria 131803
89 Ga0213876_10000672 3300021384 Bacteria 24372
90 Ga0207643_10075046 3300025908 Bacteria 1951
91 Ga0207684_10015086 3300025910 Bacteria 6652
92 Ga0207662_10048633 3300025918 Bacteria 2513
93 Ga0207646_10025707 3300025922 Bacteria 5384
94 Ga0207694_10000001 3300025924 Bacteria 4078485
95 Ga0207650_10000021 3300025925 Bacteria 322394
96 Ga0207650_10071865 3300025925 Bacteria 2604
97 Ga0207650_10223574 3300025925 Bacteria 1516
98 Ga0207659_10000005 3300025926 Bacteria 405839
99 Ga0207687_10001964 3300025927 Bacteria 14156
100 Ga0207687_10003989 3300025927 Bacteria 9891
101 Ga0207700_10017033 3300025928 Bacteria 4842
102 Ga0207686_10000747 3300025934 Bacteria 20053
103 Ga0207686_10180489 3300025934 Bacteria 1497
104 Ga0207670_10007966 3300025936 Bacteria 5953
105 Ga0207670_10024859 3300025936 Bacteria 3751
106 Ga0207665_10183748 3300025939 Bacteria 1515
107 Ga0207691_10051055 3300025940 Unclassified 3783
108 Ga0207661_10000007 3300025944 Bacteria 471636
109 Ga0207712_10106896 3300025961 Unclassified 2091
110 Ga0207640_10012682 3300025981 Bacteria 4807
111 Ga0207677_10000090 3300026023 Bacteria 74352
112 Ga0207677_10000126 3300026023 Bacteria 63024
113 Ga0207703_10000099 3300026035 Bacteria 103567
114 Ga0207678_10050929 3300026067 Bacteria 3576
115 Ga0207708_10000018 3300026075 Bacteria 188140
116 Ga0207648_10025869 3300026089 Bacteria 5220
117 Ga0207676_10000063 3300026095 Bacteria 110993
118 Ga0207674_10099930 3300026116 Bacteria 2883
119 Ga0207683_10319320 3300026121 Bacteria 1423
120 Ga0207428_10000003 3300027907 Bacteria 799783
121 Ga0268264_10148402 3300028381 Unclassified 2099
122 Ga0307515_10158080 3300028794 Bacteria 2328
123 Ga0307513_10124751 3300031456 Bacteria 2533
124 Ga0307405_10026097 3300031731 Unclassified 3365
125 Ga0307413_10001352 3300031824 Bacteria 9181
126 Ga0307410_10003736 3300031852 Bacteria 7710
127 Ga0307406_10056788 3300031901 Bacteria 2509
128 Ga0307406_10098416 3300031901 Bacteria 1986
129 Ga0307407_10000319 3300031903 Bacteria 14319
130 Ga0307407_10014199 3300031903 Unclassified 3893
131 Ga0307407_10038472 3300031903 Unclassified 2651
132 Ga0307412_10022244 3300031911 Bacteria 3884
133 Ga0307409_100004348 3300031995 Bacteria 7943
134 Ga0307416_100061310 3300032002 Bacteria 3069
135 Ga0307416_100290651 3300032002 Unclassified 1618
136 Ga0307416_100342425 3300032002 Bacteria 1509
137 Ga0307414_10038573 3300032004 Unclassified 3210
138 Ga0307414_10163899 3300032004 Bacteria 1769
139 Ga0307411_10007019 3300032005 Bacteria 5693
140 Ga0307415_100055562 3300032126 Bacteria 2710
141 Ga0307415_100305581 3300032126 Bacteria 1320
142 Ga0373944_0007075 3300035089 Bacteria 2999
143 Ga0373932_0001703 3300035112 Bacteria 5979
144 Ga0373947_0184099 3300035725 Bacteria 1361
145 Ga0395905_0065230 3300037471 Bacteria 3409
146 Ga0436365_0706054 3300039437 Bacteria 124498
147 Ga0436365_0774883 3300039437 Bacteria 390569
148 Ga0436365_1344587 3300039437 Bacteria 210334
149 Ga0436363_1221248 3300039450 Bacteria 4924
150 Ga0436362_0660519 3300039453 Bacteria 832172
151 Ga0436362_0736466 3300039453 Bacteria 11594
152 Ga0439432_018868 3300042006 Unclassified 2302
153 Ga0439432_025450 3300042006 Bacteria 1942
154 Ga0453683_0084765 3300044673 Unclassified 1985
155 Ga0466959_0023219 3300045049 Unclassified 4589
156 Ga0495620_0011696 3300046515 Bacteria 4565
157 Ga0495632_0004854 3300046519 Bacteria 9026
158 Ga0495668_0000102 3300046616 Bacteria 137192
159 Ga0496106_0135292 3300048909 Bacteria 1935
160 Ga0501072_0000962 3300049588 Bacteria 21238
161 Ga0501202_025386 3300049652 Unclassified 1207
162 Ga0501080_0070774 3300049742 Unclassified 3244
163 nmdc:mga09592_420441_c1 3300050508 Bacteria 1154
164 nmdc:mga06r32_18531_c1 3300050510 Bacteria 6375
165 nmdc:mga08y16_4_c1 3300050511 Bacteria 916963
166 nmdc:mga08y16_85246_c2 3300050511 Bacteria 2990
167 nmdc:mga0n895_140489_c1 3300050512 Bacteria 2443
168 nmdc:mga0n895_236196_c1 3300050512 Bacteria 1855
169 nmdc:mga0rr50_5012_c1 3300050513 Bacteria 7844
170 nmdc:mga08x19_7388_c1 3300050514 Bacteria 6524
171 Ga0495655_0000026 3300053083 Bacteria 34668
172 Ga0500568_0012868 3300053139 Bacteria 3833
173 Ga0500616_0001229 3300053153 Bacteria 25755
174 Ga0207687_10000006
175 LJQas_1000052
176 rootL2_10226496
177 Ga0065715_10021978
178 Ga0065715_10109395
179 Ga0070670_100000131
180 Ga0070680_100005029
181 Ga0070682_100000001
182 Ga0068868_100001221
183 Ga0068868_100016653
184 Ga0070689_100012153
185 Ga0070692_10025714
186 Ga0070675_100000002
187 Ga0070709_10017277
188 Ga0070709_10024713
189 Ga0070714_100000069
190 Ga0070713_100154741
191 Ga0070701_10022554
192 Ga0070708_100084584
193 Ga0070681_10016605
194 Ga0070706_100014358
195 Ga0070706_100019016
196 Ga0070707_100003590
197 Ga0070698_100042595
198 Ga0070698_100271215
199 Ga0070699_100030413
200 Ga0070699_100063460
201 Ga0070699_100158287
202 Ga0070679_100034313
203 Ga0070684_100001071
204 Ga0070672_100022061
205 Ga0070695_100023982
206 Ga0070665_100084520
207 Ga0068857_100034902
208 Ga0068854_100011343
209 Ga0068854_100038435
210 Ga0070702_100042617
211 Ga0070702_100148199
212 Ga0068859_100018415
213 Ga0068864_100060629
214 Ga0068870_10090188
215 Ga0068863_100079324
216 Ga0068858_100034071
217 Ga0068860_100021234
218 Ga0070717_10000050
219 Ga0070716_100155901
220 Ga0097621_100006136
221 Ga0097621_100310959
222 Ga0068871_100101808
223 Ga0075431_100022939
224 Ga0075434_100126471
225 Ga0075436_100046540
226 Ga0097620_100018414
227 Ga0105244_10071625
228 Ga0105240_10025561
229 Ga0111539_10000018
230 Ga0111539_10103245
231 Ga0105245_10000027
232 Ga0105245_10000770
233 Ga0105245_10000817
234 Ga0105247_10095015
235 Ga0114129_10136904
236 Ga0114129_10332036
237 Ga0105242_10000937
238 Ga0105242_10048340
239 Ga0105237_10120986
240 Ga0105238_10000118
241 Ga0105249_10008120
242 Ga0105249_10031045
243 Ga0157369_10000123
244 Ga0157374_10000019
245 Ga0157378_10038526
246 Ga0157378_10167494
247 Ga0163162_10119583
248 Ga0157375_10000001
249 Ga0157375_10017041
250 Ga0157375_10036051
251 Ga0157375_10203411
252 Ga0157375_10278115
253 Ga0163163_10134014
254 Ga0157380_10000970
255 Ga0157380_10013273
256 Ga0157377_10000110
257 Ga0157377_10066363
258 Ga0157376_10000011
259 Ga0213873_10000002
260 Ga0213876_10000001
261 Ga0213876_10000060
262 Ga0213876_10000672
263 Ga0207643_10075046
264 Ga0207684_10015086
265 Ga0207662_10048633
266 Ga0207646_10025707
267 Ga0207694_10000001
268 Ga0207650_10000021
269 Ga0207650_10071865
270 Ga0207650_10223574
271 Ga0207659_10000005
272 Ga0207687_10001964
273 Ga0207687_10003989
274 Ga0207700_10017033
275 Ga0207686_10000747
276 Ga0207686_10180489
277 Ga0207670_10007966
278 Ga0207670_10024859
279 Ga0207665_10183748
280 Ga0207691_10051055
281 Ga0207661_10000007
282 Ga0207712_10106896
283 Ga0207640_10012682
284 Ga0207677_10000090
285 Ga0207677_10000126
286 Ga0207703_10000099
287 Ga0207678_10050929
288 Ga0207708_10000018
289 Ga0207648_10025869
290 Ga0207676_10000063
291 Ga0207674_10099930
292 Ga0207683_10319320
293 Ga0207428_10000003
294 Ga0268264_10148402
295 Ga0307515_10158080
296 Ga0307513_10124751
297 Ga0307405_10026097
298 Ga0307413_10001352
299 Ga0307410_10003736
300 Ga0307406_10056788
301 Ga0307406_10098416
302 Ga0307407_10000319
303 Ga0307407_10014199
304 Ga0307407_10038472
305 Ga0307412_10022244
306 Ga0307409_100004348
307 Ga0307416_100061310
308 Ga0307416_100290651
309 Ga0307416_100342425
310 Ga0307414_10038573
311 Ga0307414_10163899
312 Ga0307411_10007019
313 Ga0307415_100055562
314 Ga0307415_100305581
315 Ga0373944_0007075
316 Ga0373932_0001703
317 Ga0373947_0184099
318 Ga0395905_0065230
319 Ga0436365_0706054
320 Ga0436365_0774883
321 Ga0436365_1344587
322 Ga0436363_1221248
323 Ga0436362_0660519
324 Ga0436362_0736466
325 Ga0439432_018868
326 Ga0439432_025450
327 Ga0453683_0084765
328 Ga0466959_0023219
329 Ga0495620_0011696
330 Ga0495632_0004854
331 Ga0495668_0000102
332 Ga0496106_0135292
333 Ga0501072_0000962
334 Ga0501202_025386
335 Ga0501080_0070774
336 nmdc:mga09592_420441_c1
337 nmdc:mga06r32_18531_c1
338 nmdc:mga08y16_4_c1
339 nmdc:mga08y16_85246_c2
340 nmdc:mga0n895_140489_c1
341 nmdc:mga0n895_236196_c1
342 nmdc:mga0rr50_5012_c1
343 nmdc:mga08x19_7388_c1
344 Ga0495655_0000026
345 Ga0500568_0012868
346 Ga0500616_0001229

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03435

Sacchrp_dh_NADP

Saccharopine dehydrogenase NADP binding domain

82

202

0.96

PF16653

Sacchrp_dh_C

Saccharopine dehydrogenase C-terminal domain

206

449

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3abi-assembly1.cif.gz_A crystal structure of l-lysine dehydrogenase from hyperthermophilic archaeon pyrococcus horikoshii 0.8834 1 363
3abi-assembly1.cif.gz_A crystal structure of l-lysine dehydrogenase from hyperthermophilic archaeon pyrococcus horikoshii 0.8761 1 363
3abi-assembly1.cif.gz_B crystal structure of l-lysine dehydrogenase from hyperthermophilic archaeon pyrococcus horikoshii 0.868 1 363
3abi-assembly1.cif.gz_B crystal structure of l-lysine dehydrogenase from hyperthermophilic archaeon pyrococcus horikoshii 0.8608 1 363
8h50-assembly1.cif.gz_B crystal structure of carboxyspermidine dehydrogenase from helicobacter pylori in space group c2221 0.8568 1 367
ID Description Score Start End Superfamily
3a63B02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9132 117 307 3.30.360.10
3a63B02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8833 117 307 3.30.360.10
af_A0A0N7KSE7_9_129_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8778 36 130 3.40.50.720
af_A0A0P0Y6T5_38_191_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8596 1 130 3.40.50.720
3euwA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8522 1 85 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Y2DQ86-F1-model_v4 Saccharopine dehydrogenase 0.9838 1 366 GO:0016491
AF-A0A7V5GXS4-F1-model_v4 Saccharopine dehydrogenase 0.9833 54 367 GO:0016491
AF-A0A136JNJ7-F1-model_v4 deleted 0.9806 1 344
AF-A0A3D0CUG9-F1-model_v4 Saccharopine dehydrogenase 0.9798 1 367 GO:0016491
AF-A0A7Y2DQ86-F1-model_v4 Saccharopine dehydrogenase 0.9785 1 366 GO:0016491

Map