F262747

General Info

Members Datasets Scaffolds Average Seq Length
173 113 346 280

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10288508|Ga0207699_102885082
Length 289
Sequence VTPSLDQSYRHCRSIARRRAKNFYYAFLLLPRDQRNSMCAIYAFMRYCDDLSDEPGASREPLDRWRIALDHALAGQYDGHPTLPAFHDTVKRYQIPPEYFHEMIDGVSSDLQPRRIRTFDELYRYCYQVASVVGLTTIHIFGFDSPAALPLAEKCGIAFQLTNILRDVREDLNRGRIYLPNEDLKRFAVSPDNLKSPEFIDLMRFEAARAREYYKKSQPLLGMVHARSRPSLWALIEIYSRLLAKIEASNYDVLSRRIALSPLEKSWIVLLAWSGLSRLLCRPSGRHSG

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
53 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
54 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
55 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
58 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
65 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
66 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
67 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
96 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.16
Rhizosphere 91.91
Stem 0
Stem Tuber 0
Unclassified 15.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10288508 3300025906 Unclassified 1143
2 Ga0070658_10015547 3300005327 Bacteria 6086
3 Ga0070658_10094291 3300005327 Bacteria 2469
4 Ga0070683_100000018 3300005329 Bacteria 193063
5 Ga0070683_100403767 3300005329 Bacteria 1303
6 Ga0070680_100001126 3300005336 Bacteria 19201
7 Ga0070680_100109360 3300005336 Unclassified 2300
8 Ga0070682_100318173 3300005337 Bacteria 1148
9 Ga0070689_100157400 3300005340 Bacteria 1835
10 Ga0070673_100187340 3300005364 Bacteria 1775
11 Ga0070713_100028675 3300005436 Bacteria 4398
12 Ga0070713_100344887 3300005436 Unclassified 1381
13 Ga0070681_10019204 3300005458 Bacteria 6841
14 Ga0070681_10239736 3300005458 Unclassified 1727
15 Ga0070685_10248582 3300005466 Bacteria 1177
16 Ga0070699_100382859 3300005518 Archaea 1270
17 Ga0070679_100176626 3300005530 Bacteria 2108
18 Ga0070684_100000011 3300005535 Bacteria 170628
19 Ga0070684_100120308 3300005535 Bacteria 2362
20 Ga0070665_100038252 3300005548 Bacteria 4823
21 Ga0070665_100192049 3300005548 Bacteria 2043
22 Ga0068855_100001625 3300005563 Bacteria 28179
23 Ga0068855_100092928 3300005563 Unclassified 3479
24 Ga0068856_100141046 3300005614 Bacteria 2417
25 Ga0068852_100005606 3300005616 Bacteria 9003
26 Ga0068861_100459865 3300005719 Bacteria 1142
27 Ga0097621_100086529 3300006237 Bacteria 2616
28 Ga0068871_100513492 3300006358 Bacteria 1081
29 Ga0075436_100114597 3300006914 Bacteria 1882
30 Ga0105240_10001273 3300009093 Bacteria 43600
31 Ga0105240_10117530 3300009093 Bacteria 3205
32 Ga0114129_10020339 3300009147 Bacteria 9442
33 Ga0105241_10193605 3300009174 Bacteria 1694
34 Ga0105248_10050329 3300009177 Bacteria 4672
35 Ga0105237_10021162 3300009545 Bacteria 6690
36 Ga0105237_10083569 3300009545 Bacteria 3184
37 Ga0105237_10162983 3300009545 Bacteria 2228
38 Ga0105237_10305744 3300009545 Bacteria 1593
39 Ga0157370_10000785 3300013104 Bacteria 39881
40 Ga0157369_10030816 3300013105 Bacteria 5913
41 Ga0157369_10043962 3300013105 Bacteria 4865
42 Ga0157369_10757421 3300013105 Unclassified 999
43 Ga0163162_10279745 3300013306 Bacteria 1801
44 Ga0157372_10023427 3300013307 Bacteria 6692
45 Ga0157372_10165730 3300013307 Bacteria 2555
46 Ga0157372_10412653 3300013307 Bacteria 1574
47 Ga0157375_10194848 3300013308 Unclassified 2181
48 Ga0157375_10829512 3300013308 Bacteria 1072
49 Ga0163163_10214783 3300014325 Bacteria 1972
50 Ga0163163_10293403 3300014325 Bacteria 1678
51 Ga0157376_10063988 3300014969 Bacteria 3100
52 Ga0157376_10816369 3300014969 Bacteria 946
53 Ga0213872_10000545 3300021361 Bacteria 29288
54 Ga0213875_10056817 3300021388 Bacteria 1833
55 Ga0207705_10062417 3300025909 Bacteria 2692
56 Ga0207705_10135083 3300025909 Bacteria 1838
57 Ga0207707_10098804 3300025912 Unclassified 2551
58 Ga0207707_10241134 3300025912 Bacteria 1572
59 Ga0207695_10005904 3300025913 Bacteria 16058
60 Ga0207695_10118733 3300025913 Bacteria 2615
61 Ga0207671_10030237 3300025914 Bacteria 4040
62 Ga0207671_10392738 3300025914 Bacteria 1103
63 Ga0207660_10002636 3300025917 Bacteria 11764
64 Ga0207660_10079620 3300025917 Unclassified 2404
65 Ga0207700_10056068 3300025928 Bacteria 2965
66 Ga0207644_10119145 3300025931 Bacteria 2007
67 Ga0207711_10131862 3300025941 Bacteria 2241
68 Ga0207711_10271494 3300025941 Bacteria 1560
69 Ga0207661_10000025 3300025944 Bacteria 195900
70 Ga0207661_10116444 3300025944 Bacteria 2269
71 Ga0207667_10007885 3300025949 Bacteria 12712
72 Ga0207651_10004554 3300025960 Bacteria 7010
73 Ga0207651_10052511 3300025960 Unclassified 2780
74 Ga0207678_10095383 3300026067 Bacteria 2542
75 Ga0207683_10538467 3300026121 Unclassified 1079
76 Ga0207698_10003530 3300026142 Bacteria 9431
77 Ga0268266_10042345 3300028379 Bacteria 3889
78 Ga0268266_10207303 3300028379 Bacteria 1797
79 Ga0265338_10017936 3300028800 Bacteria 7601
80 Ga0265324_10013392 3300029957 Bacteria 3062
81 Ga0265330_10087803 3300031235 Bacteria 1336
82 Ga0265332_10057080 3300031238 Bacteria 1673
83 Ga0265328_10044014 3300031239 Bacteria 1642
84 Ga0265320_10007822 3300031240 Bacteria 6601
85 Ga0265329_10010446 3300031242 Unclassified 3408
86 Ga0265340_10035641 3300031247 Bacteria 2471
87 Ga0265339_10074881 3300031249 Bacteria 1798
88 Ga0265339_10151749 3300031249 Bacteria 1171
89 Ga0265331_10021782 3300031250 Bacteria 3275
90 Ga0265316_10001474 3300031344 Bacteria 25216
91 Ga0265316_10002270 3300031344 Bacteria 20139
92 Ga0265316_10013090 3300031344 Bacteria 7398
93 Ga0265316_10016398 3300031344 Bacteria 6427
94 Ga0265316_10267796 3300031344 Bacteria 1251
95 Ga0265314_10010128 3300031711 Bacteria 7901
96 Ga0265314_10058709 3300031711 Bacteria 2636
97 Ga0265342_10052454 3300031712 Bacteria 2431
98 Ga0373926_0012702 3300035083 Bacteria 2849
99 Ga0373953_0062398 3300035117 Bacteria 1526
100 Ga0373946_0097406 3300035171 Bacteria 1313
101 Ga0373935_0018118 3300035692 Bacteria 4280
102 Ga0373927_0000816 3300035695 Bacteria 23841
103 Ga0373927_0001796 3300035695 Bacteria 16009
104 Ga0373947_0000981 3300035725 Bacteria 17418
105 Ga0373947_0136687 3300035725 Bacteria 1569
106 Ga0373947_0225465 3300035725 Bacteria 1233
107 Ga0373937_0370804 3300036401 Bacteria 1357
108 Ga0373925_0000090 3300037068 Bacteria 97041
109 Ga0436364_0140214 3300037853 Unclassified 858
110 Ga0436364_0390899 3300037853 Unclassified 1007
111 Ga0436364_0401315 3300037853 Bacteria 1341
112 Ga0436364_0481712 3300037853 Bacteria 5505
113 Ga0436364_0563199 3300037853 Bacteria 4514
114 Ga0436364_0610902 3300037853 Bacteria 1375
115 Ga0436364_0636978 3300037853 Bacteria 854
116 Ga0436364_1213711 3300037853 Bacteria 3874
117 Ga0436365_0990379 3300039437 Bacteria 2179
118 Ga0436365_1196305 3300039437 Bacteria 3533
119 Ga0436360_0254152 3300039438 Bacteria 11137
120 Ga0436361_0176121 3300039447 Bacteria 2437
121 Ga0436361_0419405 3300039447 Bacteria 103155
122 Ga0466963_0320961 3300044694 Unclassified 1090
123 Ga0453684_0221446 3300044712 Bacteria 2192
124 Ga0451576_0062632 3300045051 Bacteria 3877
125 Ga0451576_0345570 3300045051 Bacteria 1558
126 Ga0466967_0042729 3300045976 Unclassified 3919
127 Ga0466967_0171486 3300045976 Bacteria 2042
128 Ga0495592_0038084 3300046454 Bacteria 3619
129 Ga0495651_0004332 3300046462 Bacteria 10871
130 Ga0495651_0266371 3300046462 Bacteria 1164
131 Ga0495580_0010843 3300046472 Bacteria 7071
132 Ga0495580_0014390 3300046472 Bacteria 6000
133 Ga0495580_0182017 3300046472 Bacteria 1451
134 Ga0495662_0002180 3300046476 Bacteria 9847
135 Ga0495664_0007138 3300046477 Bacteria 6192
136 Ga0495618_0024277 3300046514 Bacteria 3754
137 Ga0495628_0030142 3300046516 Bacteria 4393
138 Ga0495630_0060930 3300046517 Bacteria 2833
139 Ga0495652_0044342 3300046529 Bacteria 3830
140 Ga0495640_0035112 3300046533 Bacteria 3550
141 Ga0495587_0043466 3300046536 Unclassified 2676
142 Ga0495587_0076977 3300046536 Bacteria 1937
143 Ga0495645_0000398 3300046543 Bacteria 30095
144 Ga0495645_0062408 3300046543 Bacteria 2699
145 Ga0495645_0196595 3300046543 Unclassified 1371
146 Ga0495667_0001850 3300046559 Bacteria 14036
147 Ga0495634_0287740 3300046642 Unclassified 996
148 Ga0495599_0074147 3300046678 Unclassified 2124
149 Ga0495623_0018374 3300046679 Unclassified 4515
150 Ga0495646_0078604 3300046680 Bacteria 1928
151 Ga0495613_0054217 3300046689 Bacteria 2948
152 Ga0495624_0118968 3300046690 Unclassified 1623
153 Ga0495624_0302222 3300046690 Bacteria 965
154 Ga0495604_0013143 3300047317 Bacteria 6592
155 Ga0495604_0108840 3300047317 Bacteria 2023
156 Ga0495674_0006451 3300047319 Bacteria 11248
157 Ga0495680_0036653 3300047322 Bacteria 3935
158 Ga0495675_0046403 3300047444 Bacteria 2766
159 Ga0495684_0023531 3300047471 Bacteria 4736
160 Ga0495684_0072597 3300047471 Bacteria 2614
161 Ga0495602_0015287 3300048088 Bacteria 7753
162 Ga0495602_0087049 3300048088 Unclassified 2606
163 Ga0495602_0202542 3300048088 Bacteria 1513
164 Ga0495602_0323932 3300048088 Bacteria 1120
165 Ga0496112_0332278 3300048915 Bacteria 1464
166 Ga0496115_0142432 3300048918 Bacteria 1978
167 Ga0496126_0443759 3300048929 Unclassified 1046
168 Ga0501083_0185055 3300049744 Bacteria 1360
169 nmdc:mga09592_870923_c1 3300050508 Unclassified 758
170 nmdc:mga06r32_59943_c1 3300050510 Unclassified 2764
171 nmdc:mga08x19_410_c1 3300050514 Bacteria 30075
172 Ga0495601_0050805 3300053077 Bacteria 2616
173 Ga0501082_0000272 3300060353 Bacteria 45665
174 Ga0207699_10288508
175 Ga0070658_10015547
176 Ga0070658_10094291
177 Ga0070683_100000018
178 Ga0070683_100403767
179 Ga0070680_100001126
180 Ga0070680_100109360
181 Ga0070682_100318173
182 Ga0070689_100157400
183 Ga0070673_100187340
184 Ga0070713_100028675
185 Ga0070713_100344887
186 Ga0070681_10019204
187 Ga0070681_10239736
188 Ga0070685_10248582
189 Ga0070699_100382859
190 Ga0070679_100176626
191 Ga0070684_100000011
192 Ga0070684_100120308
193 Ga0070665_100038252
194 Ga0070665_100192049
195 Ga0068855_100001625
196 Ga0068855_100092928
197 Ga0068856_100141046
198 Ga0068852_100005606
199 Ga0068861_100459865
200 Ga0097621_100086529
201 Ga0068871_100513492
202 Ga0075436_100114597
203 Ga0105240_10001273
204 Ga0105240_10117530
205 Ga0114129_10020339
206 Ga0105241_10193605
207 Ga0105248_10050329
208 Ga0105237_10021162
209 Ga0105237_10083569
210 Ga0105237_10162983
211 Ga0105237_10305744
212 Ga0157370_10000785
213 Ga0157369_10030816
214 Ga0157369_10043962
215 Ga0157369_10757421
216 Ga0163162_10279745
217 Ga0157372_10023427
218 Ga0157372_10165730
219 Ga0157372_10412653
220 Ga0157375_10194848
221 Ga0157375_10829512
222 Ga0163163_10214783
223 Ga0163163_10293403
224 Ga0157376_10063988
225 Ga0157376_10816369
226 Ga0213872_10000545
227 Ga0213875_10056817
228 Ga0207705_10062417
229 Ga0207705_10135083
230 Ga0207707_10098804
231 Ga0207707_10241134
232 Ga0207695_10005904
233 Ga0207695_10118733
234 Ga0207671_10030237
235 Ga0207671_10392738
236 Ga0207660_10002636
237 Ga0207660_10079620
238 Ga0207700_10056068
239 Ga0207644_10119145
240 Ga0207711_10131862
241 Ga0207711_10271494
242 Ga0207661_10000025
243 Ga0207661_10116444
244 Ga0207667_10007885
245 Ga0207651_10004554
246 Ga0207651_10052511
247 Ga0207678_10095383
248 Ga0207683_10538467
249 Ga0207698_10003530
250 Ga0268266_10042345
251 Ga0268266_10207303
252 Ga0265338_10017936
253 Ga0265324_10013392
254 Ga0265330_10087803
255 Ga0265332_10057080
256 Ga0265328_10044014
257 Ga0265320_10007822
258 Ga0265329_10010446
259 Ga0265340_10035641
260 Ga0265339_10074881
261 Ga0265339_10151749
262 Ga0265331_10021782
263 Ga0265316_10001474
264 Ga0265316_10002270
265 Ga0265316_10013090
266 Ga0265316_10016398
267 Ga0265316_10267796
268 Ga0265314_10010128
269 Ga0265314_10058709
270 Ga0265342_10052454
271 Ga0373926_0012702
272 Ga0373953_0062398
273 Ga0373946_0097406
274 Ga0373935_0018118
275 Ga0373927_0000816
276 Ga0373927_0001796
277 Ga0373947_0000981
278 Ga0373947_0136687
279 Ga0373947_0225465
280 Ga0373937_0370804
281 Ga0373925_0000090
282 Ga0436364_0140214
283 Ga0436364_0390899
284 Ga0436364_0401315
285 Ga0436364_0481712
286 Ga0436364_0563199
287 Ga0436364_0610902
288 Ga0436364_0636978
289 Ga0436364_1213711
290 Ga0436365_0990379
291 Ga0436365_1196305
292 Ga0436360_0254152
293 Ga0436361_0176121
294 Ga0436361_0419405
295 Ga0466963_0320961
296 Ga0453684_0221446
297 Ga0451576_0062632
298 Ga0451576_0345570
299 Ga0466967_0042729
300 Ga0466967_0171486
301 Ga0495592_0038084
302 Ga0495651_0004332
303 Ga0495651_0266371
304 Ga0495580_0010843
305 Ga0495580_0014390
306 Ga0495580_0182017
307 Ga0495662_0002180
308 Ga0495664_0007138
309 Ga0495618_0024277
310 Ga0495628_0030142
311 Ga0495630_0060930
312 Ga0495652_0044342
313 Ga0495640_0035112
314 Ga0495587_0043466
315 Ga0495587_0076977
316 Ga0495645_0000398
317 Ga0495645_0062408
318 Ga0495645_0196595
319 Ga0495667_0001850
320 Ga0495634_0287740
321 Ga0495599_0074147
322 Ga0495623_0018374
323 Ga0495646_0078604
324 Ga0495613_0054217
325 Ga0495624_0118968
326 Ga0495624_0302222
327 Ga0495604_0013143
328 Ga0495604_0108840
329 Ga0495674_0006451
330 Ga0495680_0036653
331 Ga0495675_0046403
332 Ga0495684_0023531
333 Ga0495684_0072597
334 Ga0495602_0015287
335 Ga0495602_0087049
336 Ga0495602_0202542
337 Ga0495602_0323932
338 Ga0496112_0332278
339 Ga0496115_0142432
340 Ga0496126_0443759
341 Ga0501083_0185055
342 nmdc:mga09592_870923_c1
343 nmdc:mga06r32_59943_c1
344 nmdc:mga08x19_410_c1
345 Ga0495601_0050805
346 Ga0501082_0000272

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00494

SQS_PSY

Squalene/phytoene synthase

16

264

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3we9-assembly1.cif.gz_A the crystal structure of yisp from bacillus subtilis subsp. subtilis strain 168 0.9434 4 273
5iys-assembly1.cif.gz_A crystal structure of a dehydrosqualene synthase in complex with ligand 0.9333 4 279
3vje-assembly2.cif.gz_B crystal structure of the y248a mutant of c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus in complex with zaragozic acid a 0.9152 1 278
5iys-assembly1.cif.gz_A crystal structure of a dehydrosqualene synthase in complex with ligand 0.9141 4 279
3ae0-assembly2.cif.gz_B crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with geranylgeranyl thiopyrophosphate 0.914 1 278
ID Description Score Start End Superfamily
3we9A00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9434 4 273 1.10.600.10
af_Q330K2_57_309_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9196 8 256 1.10.600.10
3w7fA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9102 1 278 1.10.600.10
4hd1A00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9093 4 254 1.10.600.10
af_P9WHP3_1_280_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9081 1 275 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A7V4ST34-F1-model_v4 Phytoene/squalene synthase family protein 0.9777 2 278 GO:0004311
GO:0016117
GO:0051996
AF-A0A1F2SZ59-F1-model_v4 Squalene synthase HpnD 0.9756 4 277 GO:0004311
GO:0016117
GO:0051996
AF-A0A7Y8J1F2-F1-model_v4 Phytoene/squalene synthase family protein 0.9748 5 279 GO:0004311
GO:0016114
GO:0051996
AF-A0A2E5FKC0-F1-model_v4 Farnesyl-diphosphate farnesyltransferase 0.9733 1 277 GO:0004311
GO:0016117
GO:0051996
AF-A0A7C5ABP1-F1-model_v4 Phytoene/squalene synthase family protein 0.9707 2 278 GO:0004311
GO:0016117
GO:0051996

Map