F262578

General Info

Members Datasets Scaffolds Average Seq Length
173 135 346 142

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10255266|Ga0105248_102552665
Length 163
Sequence MKPRGRRFSLNLRPAVEGMSVTDIVIYHNPACGTSRNILALIRNSGVEPHVIEYLKTPPARALLVQLIERAGMAPRDLLREKGTPFAELGLGDSSLSDEVLIDAMIDHPLLINRPLVVAPLGVRLCRPSEAVLDILPDAQQGAFAKEDGEPVVDAAGNRIQPT

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
17 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
47 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
48 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
49 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
52 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
53 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
54 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
55 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
56 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
57 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
58 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
59 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
60 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
61 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
62 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
63 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
64 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
65 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
66 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
67 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
68 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
69 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
70 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
71 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
72 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
73 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
74 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
75 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
76 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
77 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
78 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
79 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
80 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
81 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
82 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
91 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
92 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
93 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
94 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
95 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
96 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
97 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
98 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
99 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
105 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
106 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
107 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
108 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
109 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
110 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
114 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
117 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
118 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
119 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
120 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
121 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
122 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
125 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
126 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
127 2643221733 Bosea sp. Root381 Isolate Unclassified
128 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
129 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
130 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
131 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
132 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
133 2902330777 Methylobacterium sp. 2A Isolate Unclassified
134 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
135 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.64
Metatranscriptomes 0.58
Isolates 5.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.67
Nodule 1.73
Rhizoplane 14.45
Rhizosphere 59.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10255266 3300009177 Bacteria 1973
2 SwRhRL2b_contig_2379138 2162886007 Bacteria 1028
3 Ga0006562J51391_1043297 3300003578 Bacteria 9220
4 Ga0055536_1002996 3300003781 Bacteria 9247
5 Ga0065704_10089271 3300005289 Bacteria 2872
6 Ga0070682_100133644 3300005337 Bacteria 1682
7 Ga0070668_100009144 3300005347 Bacteria 7352
8 Ga0070659_100627926 3300005366 Bacteria 925
9 Ga0070707_100355240 3300005468 Bacteria 1423
10 Ga0070665_100147672 3300005548 Bacteria 2354
11 Ga0068852_100417433 3300005616 Bacteria 1323
12 Ga0068852_101172728 3300005616 Bacteria 789
13 Ga0068863_101173069 3300005841 Bacteria 773
14 Ga0068860_100824404 3300005843 Bacteria 942
15 Ga0075362_10429432 3300006177 Bacteria 669
16 Ga0075367_10237643 3300006178 Bacteria 1141
17 Ga0075369_10557619 3300006186 Bacteria 547
18 Ga0105244_10002506 3300009036 Bacteria 13810
19 Ga0105240_10030854 3300009093 Bacteria 6962
20 Ga0105245_11893902 3300009098 Bacteria 649
21 Ga0105237_10608100 3300009545 Bacteria 1100
22 Ga0105249_10607204 3300009553 Bacteria 1149
23 Ga0105239_10000385 3300010375 Bacteria 64470
24 Ga0157373_10128940 3300013100 Bacteria 1779
25 Ga0157371_10005798 3300013102 Bacteria 10337
26 Ga0157370_10000336 3300013104 Bacteria 59121
27 Ga0157370_10047179 3300013104 Bacteria 4129
28 Ga0157370_11370770 3300013104 Bacteria 637
29 Ga0157369_10003682 3300013105 Bacteria 18215
30 Ga0171462_1033 3300013250 Bacteria 90238
31 Ga0163162_11099685 3300013306 Bacteria 901
32 Ga0209676_1000024 3300025292 Bacteria 578839
33 Ga0207655_1002682 3300025728 Bacteria 13977
34 Ga0207655_1004642 3300025728 Bacteria 9645
35 Ga0207655_1095642 3300025728 Bacteria 1035
36 Ga0207713_1010731 3300025735 Bacteria 5046
37 Ga0207695_10008826 3300025913 Bacteria 12551
38 Ga0207664_10634435 3300025929 Bacteria 960
39 Ga0207690_10515395 3300025932 Bacteria 969
40 Ga0207711_10265656 3300025941 Bacteria 1578
41 Ga0207667_10172459 3300025949 Bacteria 2223
42 Ga0207712_10369951 3300025961 Bacteria 1196
43 Ga0207668_10003517 3300025972 Bacteria 9202
44 Ga0207668_10595714 3300025972 Bacteria 962
45 Ga0207639_10053071 3300026041 Bacteria 3091
46 Ga0207678_10287014 3300026067 Bacteria 1413
47 Ga0207641_10012950 3300026088 Bacteria 6842
48 Ga0207676_11989767 3300026095 Bacteria 580
49 Ga0207674_10899777 3300026116 Bacteria 853
50 Ga0207698_11251020 3300026142 Bacteria 757
51 Ga0268264_10541088 3300028381 Bacteria 1141
52 Ga0307515_10250741 3300028794 Bacteria 1523
53 Ga0314311_1118732 3300030733 Bacteria 582
54 Ga0265328_10000212 3300031239 Bacteria 26979
55 Ga0307405_10114729 3300031731 Bacteria 1831
56 Ga0307406_10520326 3300031901 Bacteria 968
57 Ga0307412_10002329 3300031911 Bacteria 10515
58 Ga0307412_10164072 3300031911 Bacteria 1654
59 Ga0307414_10008346 3300032004 Bacteria 5866
60 Ga0307414_10395035 3300032004 Bacteria 1199
61 Ga0307414_10975636 3300032004 Bacteria 779
62 Ga0307414_11458265 3300032004 Bacteria 636
63 Ga0439438_084322 3300041405 Bacteria 778
64 Ga0439447_025707 3300041407 Bacteria 1515
65 Ga0451787_668088 3300041441 Bacteria 994
66 Ga0451789_1058603 3300041443 Bacteria 694
67 Ga0451793_1500742 3300041452 Bacteria 2137
68 Ga0451797_0793021 3300041453 Bacteria 740
69 Ga0451795_0730495 3300041456 Bacteria 2046
70 Ga0451843_1215163 3300041509 Bacteria 782
71 Ga0451853_0355925 3300041512 Bacteria 952
72 Ga0439452_000001 3300042010 Bacteria 1725439
73 Ga0450898_019615 3300042134 Bacteria 1180
74 Ga0439459_0015025 3300042438 Bacteria 1414
75 Ga0495627_000103 3300046453 Bacteria 104335
76 Ga0495638_0000071 3300046460 Bacteria 166300
77 Ga0495638_0073113 3300046460 Bacteria 2093
78 Ga0495650_0001034 3300046471 Bacteria 31214
79 Ga0495607_0038919 3300046501 Bacteria 2844
80 Ga0495583_0028558 3300046506 Bacteria 2741
81 Ga0495610_0096250 3300046512 Bacteria 1333
82 Ga0495620_0017002 3300046515 Bacteria 3636
83 Ga0495632_0106903 3300046519 Bacteria 1316
84 Ga0495643_0044552 3300046522 Bacteria 2411
85 Ga0495643_0115766 3300046522 Bacteria 1358
86 Ga0495609_0073544 3300046538 Bacteria 1499
87 Ga0495671_0125241 3300046692 Bacteria 1253
88 Ga0495604_0793141 3300047317 Bacteria 597
89 Ga0495683_0347998 3300047323 Bacteria 626
90 Ga0495675_0468432 3300047444 Bacteria 727
91 Ga0495673_0037798 3300047469 Bacteria 2202
92 Ga0495673_0226667 3300047469 Bacteria 689
93 Ga0495681_0000174 3300047470 Bacteria 53932
94 Ga0495681_0005853 3300047470 Bacteria 8166
95 Ga0496100_0205802 3300048903 Bacteria 1437
96 Ga0496100_0944658 3300048903 Bacteria 678
97 Ga0496101_0018555 3300048904 Bacteria 4732
98 Ga0496102_0296774 3300048905 Bacteria 1523
99 Ga0496104_0000040 3300048907 Bacteria 162886
100 Ga0496104_0005605 3300048907 Bacteria 10989
101 Ga0496104_0079252 3300048907 Bacteria 3130
102 Ga0496104_0897189 3300048907 Bacteria 791
103 Ga0496105_0000060 3300048908 Bacteria 86019
104 Ga0496105_0014528 3300048908 Bacteria 6267
105 Ga0496105_0166846 3300048908 Bacteria 1806
106 Ga0496105_0211832 3300048908 Bacteria 1579
107 Ga0496108_0417093 3300048911 Bacteria 1172
108 Ga0496110_0045648 3300048913 Bacteria 3831
109 Ga0496112_0020243 3300048915 Bacteria 6301
110 Ga0496113_0015884 3300048916 Bacteria 5188
111 Ga0496114_0330385 3300048917 Bacteria 1348
112 Ga0496114_1004328 3300048917 Bacteria 718
113 Ga0496115_0129760 3300048918 Bacteria 2077
114 Ga0496115_1323471 3300048918 Bacteria 535
115 Ga0496118_0001437 3300048921 Bacteria 35866
116 Ga0496119_0004860 3300048922 Bacteria 13164
117 Ga0496119_0074941 3300048922 Bacteria 1969
118 Ga0496119_0205847 3300048922 Bacteria 1015
119 Ga0496120_0048673 3300048923 Bacteria 2438
120 Ga0496122_0013895 3300048925 Bacteria 7832
121 Ga0496122_0036738 3300048925 Bacteria 3955
122 Ga0496123_0003261 3300048926 Bacteria 18412
123 Ga0496123_0091011 3300048926 Bacteria 1811
124 Ga0496124_0015656 3300048927 Bacteria 7257
125 Ga0496124_0069656 3300048927 Bacteria 2920
126 Ga0496124_0088942 3300048927 Bacteria 2523
127 Ga0496124_0156442 3300048927 Bacteria 1782
128 Ga0496124_0225587 3300048927 Bacteria 1405
129 Ga0496125_0061102 3300048928 Bacteria 3024
130 Ga0496125_0270470 3300048928 Bacteria 1059
131 Ga0496125_0439572 3300048928 Bacteria 750
132 Ga0496126_0107932 3300048929 Bacteria 2428
133 Ga0496126_0917182 3300048929 Bacteria 663
134 Ga0501033_0176014 3300049570 Bacteria 1535
135 Ga0501034_0010531 3300049571 Bacteria 9628
136 Ga0501037_0081548 3300049573 Bacteria 2345
137 Ga0501043_0043806 3300049579 Bacteria 3518
138 Ga0501043_0184813 3300049579 Bacteria 1623
139 Ga0501223_003215 3300049663 Bacteria 3570
140 Ga0501224_000025 3300049664 Bacteria 56130
141 Ga0501233_000065 3300049668 Bacteria 14205
142 Ga0501235_017476 3300049669 Bacteria 1587
143 Ga0501225_0000402 3300049705 Bacteria 13589
144 Ga0501234_032059 3300049707 Bacteria 850
145 Ga0501241_001086 3300049758 Bacteria 5722
146 Ga0501241_012656 3300049758 Bacteria 1534
147 Ga0501241_052657 3300049758 Bacteria 806
148 Ga0501035_0376696 3300049822 Bacteria 1184
149 Ga0501044_0149971 3300049823 Bacteria 2315
150 Ga0501044_0353456 3300049823 Bacteria 1389
151 Ga0501226_000020 3300049853 Bacteria 141193
152 nmdc:mga06z11_204535_c1 3300050494 Bacteria 1148
153 nmdc:mga07m45_293954_c1 3300050496 Bacteria 945
154 nmdc:mga0sz30_468199_c1 3300050516 Bacteria 566
155 Ga0495595_0433290 3300053084 Bacteria 668
156 Ga0495619_0226590 3300053085 Bacteria 1295
157 Ga0500578_0451925 3300053086 Bacteria 731
158 Ga0500651_0304404 3300053093 Bacteria 914
159 Ga0500618_027100 3300053125 Bacteria 1364
160 Ga0500559_0169498 3300053136 Bacteria 1027
161 Ga0500616_0042066 3300053153 Bacteria 2448
162 Ga0500622_0005435 3300053156 Bacteria 7656
163 Ga0500636_0001943 3300053177 Bacteria 11357
164 2643908451 2643221579 Bacteria 4443405
165 2644729570 2643221733 Bacteria 5690728
166 2650896101 2648501693 Bacteria 5069560
167 2792621660 2791355091 Bacteria 6135441
168 2792627655 2791355092 Bacteria 6248105
169 2792640390 2791355094 Bacteria 7011481
170 2819714250 2818991466 Bacteria 4748179
171 2902330817 2902330777 Bacteria 6395352
172 2917700297 2917699015 Bacteria 7043791
173 2928530467 2928526807 Bacteria 4760224
174 Ga0105248_10255266
175 SwRhRL2b_contig_2379138
176 Ga0006562J51391_1043297
177 Ga0055536_1002996
178 Ga0065704_10089271
179 Ga0070682_100133644
180 Ga0070668_100009144
181 Ga0070659_100627926
182 Ga0070707_100355240
183 Ga0070665_100147672
184 Ga0068852_100417433
185 Ga0068852_101172728
186 Ga0068863_101173069
187 Ga0068860_100824404
188 Ga0075362_10429432
189 Ga0075367_10237643
190 Ga0075369_10557619
191 Ga0105244_10002506
192 Ga0105240_10030854
193 Ga0105245_11893902
194 Ga0105237_10608100
195 Ga0105249_10607204
196 Ga0105239_10000385
197 Ga0157373_10128940
198 Ga0157371_10005798
199 Ga0157370_10000336
200 Ga0157370_10047179
201 Ga0157370_11370770
202 Ga0157369_10003682
203 Ga0171462_1033
204 Ga0163162_11099685
205 Ga0209676_1000024
206 Ga0207655_1002682
207 Ga0207655_1004642
208 Ga0207655_1095642
209 Ga0207713_1010731
210 Ga0207695_10008826
211 Ga0207664_10634435
212 Ga0207690_10515395
213 Ga0207711_10265656
214 Ga0207667_10172459
215 Ga0207712_10369951
216 Ga0207668_10003517
217 Ga0207668_10595714
218 Ga0207639_10053071
219 Ga0207678_10287014
220 Ga0207641_10012950
221 Ga0207676_11989767
222 Ga0207674_10899777
223 Ga0207698_11251020
224 Ga0268264_10541088
225 Ga0307515_10250741
226 Ga0314311_1118732
227 Ga0265328_10000212
228 Ga0307405_10114729
229 Ga0307406_10520326
230 Ga0307412_10002329
231 Ga0307412_10164072
232 Ga0307414_10008346
233 Ga0307414_10395035
234 Ga0307414_10975636
235 Ga0307414_11458265
236 Ga0439438_084322
237 Ga0439447_025707
238 Ga0451787_668088
239 Ga0451789_1058603
240 Ga0451793_1500742
241 Ga0451797_0793021
242 Ga0451795_0730495
243 Ga0451843_1215163
244 Ga0451853_0355925
245 Ga0439452_000001
246 Ga0450898_019615
247 Ga0439459_0015025
248 Ga0495627_000103
249 Ga0495638_0000071
250 Ga0495638_0073113
251 Ga0495650_0001034
252 Ga0495607_0038919
253 Ga0495583_0028558
254 Ga0495610_0096250
255 Ga0495620_0017002
256 Ga0495632_0106903
257 Ga0495643_0044552
258 Ga0495643_0115766
259 Ga0495609_0073544
260 Ga0495671_0125241
261 Ga0495604_0793141
262 Ga0495683_0347998
263 Ga0495675_0468432
264 Ga0495673_0037798
265 Ga0495673_0226667
266 Ga0495681_0000174
267 Ga0495681_0005853
268 Ga0496100_0205802
269 Ga0496100_0944658
270 Ga0496101_0018555
271 Ga0496102_0296774
272 Ga0496104_0000040
273 Ga0496104_0005605
274 Ga0496104_0079252
275 Ga0496104_0897189
276 Ga0496105_0000060
277 Ga0496105_0014528
278 Ga0496105_0166846
279 Ga0496105_0211832
280 Ga0496108_0417093
281 Ga0496110_0045648
282 Ga0496112_0020243
283 Ga0496113_0015884
284 Ga0496114_0330385
285 Ga0496114_1004328
286 Ga0496115_0129760
287 Ga0496115_1323471
288 Ga0496118_0001437
289 Ga0496119_0004860
290 Ga0496119_0074941
291 Ga0496119_0205847
292 Ga0496120_0048673
293 Ga0496122_0013895
294 Ga0496122_0036738
295 Ga0496123_0003261
296 Ga0496123_0091011
297 Ga0496124_0015656
298 Ga0496124_0069656
299 Ga0496124_0088942
300 Ga0496124_0156442
301 Ga0496124_0225587
302 Ga0496125_0061102
303 Ga0496125_0270470
304 Ga0496125_0439572
305 Ga0496126_0107932
306 Ga0496126_0917182
307 Ga0501033_0176014
308 Ga0501034_0010531
309 Ga0501037_0081548
310 Ga0501043_0043806
311 Ga0501043_0184813
312 Ga0501223_003215
313 Ga0501224_000025
314 Ga0501233_000065
315 Ga0501235_017476
316 Ga0501225_0000402
317 Ga0501234_032059
318 Ga0501241_001086
319 Ga0501241_012656
320 Ga0501241_052657
321 Ga0501035_0376696
322 Ga0501044_0149971
323 Ga0501044_0353456
324 Ga0501226_000020
325 nmdc:mga06z11_204535_c1
326 nmdc:mga07m45_293954_c1
327 nmdc:mga0sz30_468199_c1
328 Ga0495595_0433290
329 Ga0495619_0226590
330 Ga0500578_0451925
331 Ga0500651_0304404
332 Ga0500618_027100
333 Ga0500559_0169498
334 Ga0500616_0042066
335 Ga0500622_0005435
336 Ga0500636_0001943
337 2643908451
338 2644729570
339 2650896101
340 2792621660
341 2792627655
342 2792640390
343 2819714250
344 2902330817
345 2917700297
346 2928530467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

27

135

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.9719 2 134
1sd8-assembly1.cif.gz_A arsenate reductase r60k mutant from e. coli 0.9705 2 134
1s3d-assembly1.cif.gz_A arsenate reductase r60a mutant from e. coli 0.9698 2 134
1s3c-assembly1.cif.gz_A arsenate reductase c12s mutant from e. coli 0.9697 2 134
1j9b-assembly1.cif.gz_A arsenate reductase+0.4m arsenite from e. coli 0.9645 2 134
ID Description Score Start End Superfamily
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9645 2 134 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.937 2 113 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9303 2 134 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9136 2 113 3.40.30.10
3zmkC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8856 2 31 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A437NT65-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9964 2 132 GO:0008794
GO:0046685
AF-A0A5N6L684-F1-model_v4 arsenate reductase (glutathione/glutaredoxin) (EC 1.20.4.1) 0.995 1 132 GO:0008794
GO:0046685
AF-T0GYP3-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9937 2 132 GO:0008794
GO:0046685
AF-A0A4Q0GRZ3-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9925 2 134 GO:0008794
GO:0046685
AF-A0A659UVR1-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9921 1 115 GO:0008794
GO:0046685

Map