F262545

General Info

Members Datasets Scaffolds Average Seq Length
173 101 346 393

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10093117|Ga0114129_100931174
Length 411
Sequence LWSKIIFDFKIELMTVTLINVTEAKKIILENVSSLEPVSLTLQDAAGLILAEDMYATTDIPAFPQSSMDGYAFSFSGWKQNKKLKIEGEVAAGSKETFTLAPGNAVRIFTGAAVPAGADTVIMQEKVKTQNGELIIEDENLQLGNSVRPKGSEIKTGALALEKESLLSPAAIGFLAGIGITDVKVFPNPSISIIITGNELQQPGQPLQHGQVYESNSFALKAVLKQLHINNIQILYATDKPEIVTNTLQKALQQSDVVLLTGGISVGDYDFVLQASTKCGVEKLFHKIKQRPGKPLYFGKKENKLVFGLPGNPSSVLTCFYQYVLTALEKLSKRKIGLQTLQAPLAKAFQKNIGLTHFLKGFYDGKTAMPLDAQESYRLSSFAKANCFIQIGENITSLKEGELVDVYLFPQ

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
90 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
94 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
100 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
101 2739367663 Pedobacter sp. YR510 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.89
Nodule 0
Rhizoplane 0
Rhizosphere 96.53
Stem 0
Stem Tuber 0
Unclassified 19.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10093117 3300009147 Bacteria 4175
2 Ga0065714_10073048 3300005288 Bacteria 3253
3 Ga0065712_10077592 3300005290 Bacteria 3465
4 Ga0065707_10118394 3300005295 Unclassified 2186
5 Ga0065707_10180361 3300005295 Unclassified 1422
6 Ga0070676_10032698 3300005328 Archaea 2981
7 Ga0070683_100002198 3300005329 Bacteria 15442
8 Ga0070690_100066071 3300005330 Unclassified 2340
9 Ga0068869_100020425 3300005334 Bacteria 4541
10 Ga0068869_100051048 3300005334 Bacteria 3000
11 Ga0068869_100130442 3300005334 Bacteria 1931
12 Ga0068869_100208739 3300005334 Bacteria 1543
13 Ga0070682_100009802 3300005337 Bacteria 5423
14 Ga0068868_100001278 3300005338 Bacteria 17323
15 Ga0070660_100043327 3300005339 Bacteria 3439
16 Ga0070689_100019130 3300005340 Bacteria 5059
17 Ga0070689_100040492 3300005340 Bacteria 3573
18 Ga0070687_100096691 3300005343 Bacteria 1645
19 Ga0070687_100169340 3300005343 Unclassified 1299
20 Ga0070661_100001199 3300005344 Bacteria 18295
21 Ga0070661_100167178 3300005344 Unclassified 1669
22 Ga0070671_100187113 3300005355 Unclassified 1754
23 Ga0070673_100043512 3300005364 Bacteria 3471
24 Ga0070688_100051239 3300005365 Unclassified 2575
25 Ga0070688_100091541 3300005365 Bacteria 1988
26 Ga0070659_100002681 3300005366 Bacteria 12650
27 Ga0070667_100222889 3300005367 Bacteria 1679
28 Ga0070667_100233673 3300005367 Bacteria 1640
29 Ga0070700_100135745 3300005441 Bacteria 1666
30 Ga0070662_100140530 3300005457 Bacteria 1870
31 Ga0068867_100062701 3300005459 Archaea 2762
32 Ga0070685_10005608 3300005466 Bacteria 6366
33 Ga0070685_10011303 3300005466 Bacteria 4674
34 Ga0070685_10053404 3300005466 Bacteria 2341
35 Ga0070698_100000645 3300005471 Bacteria 37282
36 Ga0070698_100008979 3300005471 Bacteria 10751
37 Ga0070698_100068393 3300005471 Bacteria 3569
38 Ga0070684_100000731 3300005535 Bacteria 22754
39 Ga0070684_100022231 3300005535 Bacteria 5286
40 Ga0070684_100044635 3300005535 Unclassified 3835
41 Ga0068853_100003450 3300005539 Bacteria 12095
42 Ga0070672_100036884 3300005543 Bacteria 3728
43 Ga0070672_100095973 3300005543 Bacteria 2398
44 Ga0070664_100000884 3300005564 Bacteria 23265
45 Ga0070664_100036166 3300005564 Bacteria 4148
46 Ga0068857_100001112 3300005577 Bacteria 20920
47 Ga0068857_100252657 3300005577 Bacteria 1616
48 Ga0068852_100049432 3300005616 Unclassified 3598
49 Ga0068852_100075752 3300005616 Bacteria 2969
50 Ga0068852_100153131 3300005616 Unclassified 2146
51 Ga0068859_100035579 3300005617 Bacteria 4996
52 Ga0068859_100069053 3300005617 Bacteria 3568
53 Ga0068859_100140385 3300005617 Unclassified 2489
54 Ga0068859_100305775 3300005617 Unclassified 1683
55 Ga0068864_100004501 3300005618 Bacteria 11462
56 Ga0068864_100023053 3300005618 Bacteria 5226
57 Ga0068864_100057609 3300005618 Bacteria 3357
58 Ga0068864_100161590 3300005618 Bacteria 2036
59 Ga0068863_100004643 3300005841 Bacteria 13544
60 Ga0068863_100040730 3300005841 Unclassified 4417
61 Ga0068863_100055607 3300005841 Bacteria 3747
62 Ga0068863_100267919 3300005841 Bacteria 1653
63 Ga0068858_100248046 3300005842 Bacteria 1691
64 Ga0081539_10017783 3300005985 Unclassified 4968
65 Ga0081539_10049446 3300005985 Unclassified 2385
66 Ga0075366_10013347 3300006195 Bacteria 4675
67 Ga0097621_100133671 3300006237 Bacteria 2114
68 Ga0068871_100234765 3300006358 Unclassified 1593
69 Ga0075428_100006620 3300006844 Bacteria 12891
70 Ga0075428_100121289 3300006844 Bacteria 2847
71 Ga0075434_100122982 3300006871 Unclassified 2611
72 Ga0075429_100006687 3300006880 Bacteria 9994
73 Ga0097620_100035579 3300006931 Bacteria 4996
74 Ga0097620_100069050 3300006931 Bacteria 3568
75 Ga0097620_100140388 3300006931 Unclassified 2489
76 Ga0097620_100305791 3300006931 Unclassified 1683
77 Ga0105242_10038204 3300009176 Unclassified 3860
78 Ga0105242_10128527 3300009176 Bacteria 2184
79 Ga0105242_10203214 3300009176 Bacteria 1761
80 Ga0105249_10001240 3300009553 Bacteria 22411
81 Ga0105249_10042851 3300009553 Bacteria 4117
82 Ga0105249_10055960 3300009553 Bacteria 3611
83 Ga0105249_10128448 3300009553 Bacteria 2417
84 Ga0105249_10240955 3300009553 Bacteria 1788
85 Ga0157373_10025044 3300013100 Bacteria 4320
86 Ga0157370_10000405 3300013104 Bacteria 54383
87 Ga0157370_10236197 3300013104 Bacteria 1692
88 Ga0157374_10000955 3300013296 Bacteria 25080
89 Ga0157374_10048274 3300013296 Unclassified 3950
90 Ga0157378_10037295 3300013297 Bacteria 4304
91 Ga0157378_10087156 3300013297 Bacteria 2832
92 Ga0163162_10029655 3300013306 Bacteria 5416
93 Ga0163162_10042164 3300013306 Bacteria 4566
94 Ga0163162_10128685 3300013306 Bacteria 2640
95 Ga0163162_10129468 3300013306 Unclassified 2632
96 Ga0163162_10170593 3300013306 Bacteria 2300
97 Ga0163162_10287792 3300013306 Bacteria 1775
98 Ga0163162_10293911 3300013306 Bacteria 1756
99 Ga0157372_10226075 3300013307 Bacteria 2169
100 Ga0157375_10002578 3300013308 Bacteria 15745
101 Ga0157375_10059161 3300013308 Bacteria 3795
102 Ga0157375_10154078 3300013308 Bacteria 2436
103 Ga0157375_10473911 3300013308 Bacteria 1417
104 Ga0163163_10000075 3300014325 Bacteria 109545
105 Ga0157380_10109338 3300014326 Unclassified 2319
106 Ga0157380_10341330 3300014326 Bacteria 1397
107 Ga0157377_10081525 3300014745 Bacteria 1892
108 Ga0157379_10030269 3300014968 Bacteria 4817
109 Ga0157376_10018590 3300014969 Bacteria 5333
110 Ga0163161_10022393 3300017792 Unclassified 4450
111 Ga0163161_10065492 3300017792 Bacteria 2652
112 Ga0207656_10059368 3300025321 Bacteria 1674
113 Ga0207645_10005381 3300025907 Bacteria 9293
114 Ga0207662_10025693 3300025918 Bacteria 3392
115 Ga0207649_10005426 3300025920 Bacteria 6902
116 Ga0207681_10050307 3300025923 Unclassified 2819
117 Ga0207650_10297953 3300025925 Bacteria 1316
118 Ga0207690_10088001 3300025932 Bacteria 2187
119 Ga0207690_10226776 3300025932 Bacteria 1432
120 Ga0207706_10027723 3300025933 Bacteria 5064
121 Ga0207706_10149620 3300025933 Archaea 2053
122 Ga0207686_10003202 3300025934 Bacteria 8808
123 Ga0207691_10030538 3300025940 Bacteria 5035
124 Ga0207691_10054732 3300025940 Bacteria 3639
125 Ga0207691_10076270 3300025940 Bacteria 3021
126 Ga0207691_10270177 3300025940 Bacteria 1464
127 Ga0207689_10019521 3300025942 Bacteria 5711
128 Ga0207689_10053617 3300025942 Bacteria 3322
129 Ga0207661_10014684 3300025944 Bacteria 5745
130 Ga0207679_10000902 3300025945 Bacteria 18967
131 Ga0207679_10024631 3300025945 Bacteria 4128
132 Ga0207651_10317065 3300025960 Bacteria 1302
133 Ga0207712_10004435 3300025961 Bacteria 8865
134 Ga0207712_10088679 3300025961 Unclassified 2272
135 Ga0207677_10015160 3300026023 Unclassified 4524
136 Ga0207639_10003196 3300026041 Bacteria 11015
137 Ga0207678_10303349 3300026067 Bacteria 1372
138 Ga0207708_10176758 3300026075 Bacteria 1693
139 Ga0207708_10191385 3300026075 Bacteria 1628
140 Ga0207641_10000380 3300026088 Bacteria 52801
141 Ga0207641_10048141 3300026088 Bacteria 3597
142 Ga0207641_10229305 3300026088 Bacteria 1725
143 Ga0207648_10012445 3300026089 Bacteria 7966
144 Ga0207676_10018751 3300026095 Bacteria 5037
145 Ga0207676_10033373 3300026095 Bacteria 3888
146 Ga0207676_10083287 3300026095 Bacteria 2604
147 Ga0207676_10127394 3300026095 Bacteria 2158
148 Ga0207674_10003262 3300026116 Bacteria 19959
149 Ga0207674_10050878 3300026116 Unclassified 4230
150 Ga0207675_100002458 3300026118 Bacteria 18348
151 Ga0207683_10127293 3300026121 Bacteria 2290
152 Ga0207698_10046073 3300026142 Bacteria 3290
153 Ga0207698_10185392 3300026142 Unclassified 1848
154 Ga0268265_10218476 3300028380 Bacteria 1666
155 Ga0307414_10034778 3300032004 Bacteria 3346
156 Ga0373933_0071397 3300035724 Bacteria 2114
157 Ga0373937_0104510 3300036401 Bacteria 2631
158 Ga0495608_0039902 3300046511 Bacteria 3146
159 Ga0495618_0096009 3300046514 Bacteria 1896
160 Ga0495598_0013604 3300046537 Unclassified 2021
161 Ga0495668_0000489 3300046616 Bacteria 49613
162 Ga0495672_0020249 3300047320 Unclassified 4365
163 Ga0495686_0061584 3300047472 Unclassified 2330
164 nmdc:mga0k408_4631_c1 3300050493 Bacteria 7285
165 nmdc:mga05p37_145992_c1 3300050507 Bacteria 2897
166 nmdc:mga09592_63781_c1 3300050508 Bacteria 3119
167 nmdc:mga06r32_141170_c1 3300050510 Bacteria 2385
168 nmdc:mga08y16_123242_c1 3300050511 Bacteria 2697
169 nmdc:mga08y16_426368_c1 3300050511 Unclassified 1355
170 Ga0500616_0009323 3300053153 Bacteria 5978
171 Ga0500616_0038031 3300053153 Bacteria 2601
172 Ga0500611_000002 3300053727 Bacteria 345991
173 2739647717 2739367663 Bacteria 5040914
174 Ga0114129_10093117
175 Ga0065714_10073048
176 Ga0065712_10077592
177 Ga0065707_10118394
178 Ga0065707_10180361
179 Ga0070676_10032698
180 Ga0070683_100002198
181 Ga0070690_100066071
182 Ga0068869_100020425
183 Ga0068869_100051048
184 Ga0068869_100130442
185 Ga0068869_100208739
186 Ga0070682_100009802
187 Ga0068868_100001278
188 Ga0070660_100043327
189 Ga0070689_100019130
190 Ga0070689_100040492
191 Ga0070687_100096691
192 Ga0070687_100169340
193 Ga0070661_100001199
194 Ga0070661_100167178
195 Ga0070671_100187113
196 Ga0070673_100043512
197 Ga0070688_100051239
198 Ga0070688_100091541
199 Ga0070659_100002681
200 Ga0070667_100222889
201 Ga0070667_100233673
202 Ga0070700_100135745
203 Ga0070662_100140530
204 Ga0068867_100062701
205 Ga0070685_10005608
206 Ga0070685_10011303
207 Ga0070685_10053404
208 Ga0070698_100000645
209 Ga0070698_100008979
210 Ga0070698_100068393
211 Ga0070684_100000731
212 Ga0070684_100022231
213 Ga0070684_100044635
214 Ga0068853_100003450
215 Ga0070672_100036884
216 Ga0070672_100095973
217 Ga0070664_100000884
218 Ga0070664_100036166
219 Ga0068857_100001112
220 Ga0068857_100252657
221 Ga0068852_100049432
222 Ga0068852_100075752
223 Ga0068852_100153131
224 Ga0068859_100035579
225 Ga0068859_100069053
226 Ga0068859_100140385
227 Ga0068859_100305775
228 Ga0068864_100004501
229 Ga0068864_100023053
230 Ga0068864_100057609
231 Ga0068864_100161590
232 Ga0068863_100004643
233 Ga0068863_100040730
234 Ga0068863_100055607
235 Ga0068863_100267919
236 Ga0068858_100248046
237 Ga0081539_10017783
238 Ga0081539_10049446
239 Ga0075366_10013347
240 Ga0097621_100133671
241 Ga0068871_100234765
242 Ga0075428_100006620
243 Ga0075428_100121289
244 Ga0075434_100122982
245 Ga0075429_100006687
246 Ga0097620_100035579
247 Ga0097620_100069050
248 Ga0097620_100140388
249 Ga0097620_100305791
250 Ga0105242_10038204
251 Ga0105242_10128527
252 Ga0105242_10203214
253 Ga0105249_10001240
254 Ga0105249_10042851
255 Ga0105249_10055960
256 Ga0105249_10128448
257 Ga0105249_10240955
258 Ga0157373_10025044
259 Ga0157370_10000405
260 Ga0157370_10236197
261 Ga0157374_10000955
262 Ga0157374_10048274
263 Ga0157378_10037295
264 Ga0157378_10087156
265 Ga0163162_10029655
266 Ga0163162_10042164
267 Ga0163162_10128685
268 Ga0163162_10129468
269 Ga0163162_10170593
270 Ga0163162_10287792
271 Ga0163162_10293911
272 Ga0157372_10226075
273 Ga0157375_10002578
274 Ga0157375_10059161
275 Ga0157375_10154078
276 Ga0157375_10473911
277 Ga0163163_10000075
278 Ga0157380_10109338
279 Ga0157380_10341330
280 Ga0157377_10081525
281 Ga0157379_10030269
282 Ga0157376_10018590
283 Ga0163161_10022393
284 Ga0163161_10065492
285 Ga0207656_10059368
286 Ga0207645_10005381
287 Ga0207662_10025693
288 Ga0207649_10005426
289 Ga0207681_10050307
290 Ga0207650_10297953
291 Ga0207690_10088001
292 Ga0207690_10226776
293 Ga0207706_10027723
294 Ga0207706_10149620
295 Ga0207686_10003202
296 Ga0207691_10030538
297 Ga0207691_10054732
298 Ga0207691_10076270
299 Ga0207691_10270177
300 Ga0207689_10019521
301 Ga0207689_10053617
302 Ga0207661_10014684
303 Ga0207679_10000902
304 Ga0207679_10024631
305 Ga0207651_10317065
306 Ga0207712_10004435
307 Ga0207712_10088679
308 Ga0207677_10015160
309 Ga0207639_10003196
310 Ga0207678_10303349
311 Ga0207708_10176758
312 Ga0207708_10191385
313 Ga0207641_10000380
314 Ga0207641_10048141
315 Ga0207641_10229305
316 Ga0207648_10012445
317 Ga0207676_10018751
318 Ga0207676_10033373
319 Ga0207676_10083287
320 Ga0207676_10127394
321 Ga0207674_10003262
322 Ga0207674_10050878
323 Ga0207675_100002458
324 Ga0207683_10127293
325 Ga0207698_10046073
326 Ga0207698_10185392
327 Ga0268265_10218476
328 Ga0307414_10034778
329 Ga0373933_0071397
330 Ga0373937_0104510
331 Ga0495608_0039902
332 Ga0495618_0096009
333 Ga0495598_0013604
334 Ga0495668_0000489
335 Ga0495672_0020249
336 Ga0495686_0061584
337 nmdc:mga0k408_4631_c1
338 nmdc:mga05p37_145992_c1
339 nmdc:mga09592_63781_c1
340 nmdc:mga06r32_141170_c1
341 nmdc:mga08y16_123242_c1
342 nmdc:mga08y16_426368_c1
343 Ga0500616_0009323
344 Ga0500616_0038031
345 Ga0500611_000002
346 2739647717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03454

MoeA_C

MoeA C-terminal region (domain IV)

342

409

0.98

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

192

330

0.97

PF03453

MoeA_N

MoeA N-terminal region (domain I and II)

19

179

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zx2-assembly1.cif.gz_D mycobacterium tuberculosis rna polymerase transcription initiation complex with ecf sigma factor sigma h and 7nt rna 0.8934 139 168
6jcy-assembly1.cif.gz_D mycobacterium tuberculosis rna polymerase transcription initiation open complex with a chimeric ecf sigma factor sigh/e 0.8743 138 168
5g2r-assembly1.cif.gz_A-2 crystal structure of the mo-insertase domain cnx1e from arabidopsis thaliana 0.8636 1 392
6gb4-assembly1.cif.gz_A-2 the structure of variant s328a of the mo-insertase domain cnx1e from arabidopsis thaliana in complex with amp and molybdate 0.8595 1 392
6gbf-assembly1.cif.gz_A-2 the structure of variant r369a of the mo-insertase domain cnx1e from arabidopsis thaliana in complex with amp 0.8585 1 392
ID Description Score Start End Superfamily
1t3eA02 Alpha Beta;Alpha-Beta Complex;Molybdopterin biosynthesis moea protein, domain 2;Molybdopterin biosynthesis moea protein, domain 2 0.9268 138 170 3.90.105.10
2fu3A02 Alpha Beta;Alpha-Beta Complex;Molybdopterin biosynthesis moea protein, domain 2;Molybdopterin biosynthesis moea protein, domain 2 0.9111 21 170 3.90.105.10
af_Q2FVY0_182_332_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9031 172 312 3.40.980.10
af_Q58080_327_398_2.40.340.10 Mainly Beta;Beta Barrel;Beta-clip;MoeA, C-terminal, domain IV 0.9028 322 392 2.40.340.10
1uz5A02 Alpha Beta;Alpha-Beta Complex;Molybdopterin biosynthesis moea protein, domain 2;Molybdopterin biosynthesis moea protein, domain 2 0.8967 138 169 3.90.105.10
ID Description Score Start End GO Terms
AF-A0A519N6J1-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.9516 189 394 GO:0005829
GO:0006777
GO:0046872
GO:0061599
AF-A0A519N6J1-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.9471 189 394 GO:0005829
GO:0006777
GO:0046872
GO:0061599
AF-A0A351GK51-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.9429 222 392 GO:0005829
GO:0006777
GO:0046872
GO:0061599
AF-A0A3B9HA16-F1-model_v4 Molybdopterin molybdenumtransferase MoeA 0.9289 321 394 GO:0016740
GO:0032324
AF-A0A661ZXI8-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.9222 188 391 GO:0005829
GO:0006777
GO:0046872
GO:0061599

Map