F262234

General Info

Members Datasets Scaffolds Average Seq Length
173 108 346 284

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100010800|Ga0070679_1000108002
Length 316
Sequence MDYPSACRLGERFVPLAPRLEVAMNGSESKQQRKRALETEAEEPHAGEGXSSREHGEEKKIQKAESLDAKTTYEVIRREGLHELERSTSALAWSGLAAGLSMGFSFLVEGLLHSHLPDTSWRPLIATFGYTVGFVIVILGSQQLFTENTLTPIVPLLSHRTGERFRNVLRLWSTVLVTNLIGALLFGLVLAKLEVVDPEVHNALAEISARAMRSGFWVTMLHAVYAGWLIAVMVWMLPAAKPQELLLVVFMTYLVGLGGFAHIIAGATEVFYAGFRDLAGWGAVLLGYLLPTLIGNVLGGVTLVAALNHAQATSGE

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
91 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
94 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
95 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
96 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
97 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
98 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
99 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
100 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
101 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
102 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
103 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
104 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
105 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
106 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.11
Stem 0
Stem Tuber 0
Unclassified 12.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100010800 3300005530 Bacteria 8672
2 MBSR1b_contig_2045597 2162886012 Unclassified 2016
3 MBSR1b_contig_6310168 2162886012 Unclassified 1689
4 JGI24737J22298_10017366 3300001990 Bacteria 2319
5 Ga0065712_10212009 3300005290 Bacteria 1069
6 Ga0065715_10123262 3300005293 Bacteria 2175
7 Ga0070658_10002245 3300005327 Bacteria 16202
8 Ga0070658_10007523 3300005327 Bacteria 8789
9 Ga0070658_10022137 3300005327 Bacteria 5098
10 Ga0070658_10078929 3300005327 Bacteria 2703
11 Ga0070658_10166271 3300005327 Bacteria 1852
12 Ga0070658_10181042 3300005327 Unclassified 1773
13 Ga0070658_10197570 3300005327 Bacteria 1696
14 Ga0070676_10110463 3300005328 Unclassified 1711
15 Ga0070683_100390802 3300005329 Bacteria 1326
16 Ga0070670_100005152 3300005331 Bacteria 10997
17 Ga0070680_100064173 3300005336 Bacteria 3010
18 Ga0070660_100023990 3300005339 Bacteria 4523
19 Ga0070660_100045562 3300005339 Bacteria 3358
20 Ga0070660_100089024 3300005339 Bacteria 2432
21 Ga0070661_100040514 3300005344 Bacteria 3399
22 Ga0070661_100317987 3300005344 Bacteria 1215
23 Ga0070692_10012342 3300005345 Bacteria 3951
24 Ga0070675_100026958 3300005354 Bacteria 4613
25 Ga0070671_100134043 3300005355 Bacteria 2087
26 Ga0070671_100177616 3300005355 Bacteria 1802
27 Ga0070671_100265502 3300005355 Bacteria 1459
28 Ga0070674_100147001 3300005356 Bacteria 1775
29 Ga0070673_100074513 3300005364 Bacteria 2735
30 Ga0070659_100138697 3300005366 Bacteria 1979
31 Ga0070714_100084302 3300005435 Bacteria 2773
32 Ga0070662_100070302 3300005457 Bacteria 2579
33 Ga0068867_100246380 3300005459 Unclassified 1451
34 Ga0070685_10002776 3300005466 Bacteria 8955
35 Ga0070685_10143471 3300005466 Bacteria 1506
36 Ga0070679_100323574 3300005530 Bacteria 1491
37 Ga0070684_100174705 3300005535 Bacteria 1952
38 Ga0070665_100112702 3300005548 Bacteria 2722
39 Ga0068855_100000029 3300005563 Bacteria 171278
40 Ga0068855_100002020 3300005563 Bacteria 25162
41 Ga0068855_100050008 3300005563 Bacteria 4928
42 Ga0068855_100102538 3300005563 Bacteria 3293
43 Ga0070664_100107935 3300005564 Bacteria 2427
44 Ga0068857_100098884 3300005577 Bacteria 2617
45 Ga0068854_100011737 3300005578 Bacteria 5717
46 Ga0068854_100067931 3300005578 Unclassified 2598
47 Ga0068856_100379766 3300005614 Bacteria 1432
48 Ga0068852_100008257 3300005616 Bacteria 7659
49 Ga0068852_100241973 3300005616 Bacteria 1725
50 Ga0068863_100813939 3300005841 Bacteria 932
51 Ga0105240_10012767 3300009093 Bacteria 11577
52 Ga0105238_10000007 3300009551 Bacteria 309725
53 Ga0157373_10034638 3300013100 Bacteria 3627
54 Ga0157373_10154077 3300013100 Bacteria 1617
55 Ga0157373_10217346 3300013100 Viruses 1348
56 Ga0157369_10024487 3300013105 Bacteria 6714
57 Ga0157369_10063663 3300013105 Bacteria 3973
58 Ga0157369_10236395 3300013105 Bacteria 1909
59 Ga0157372_10013360 3300013307 Bacteria 8765
60 Ga0157372_10016213 3300013307 Bacteria 7994
61 Ga0157372_10017078 3300013307 Bacteria 7791
62 Ga0157372_10066267 3300013307 Bacteria 4057
63 Ga0157372_10068873 3300013307 Unclassified 3979
64 Ga0157372_10160954 3300013307 Bacteria 2594
65 Ga0157372_10607672 3300013307 Bacteria 1274
66 Ga0157372_10750461 3300013307 Bacteria 1135
67 Ga0157375_10153201 3300013308 Bacteria 2442
68 Ga0213876_10165275 3300021384 Bacteria 1177
69 Ga0213875_10006237 3300021388 Bacteria 6283
70 Ga0207647_10062715 3300025904 Bacteria 2263
71 Ga0207647_10139732 3300025904 Unclassified 1420
72 Ga0207645_10234970 3300025907 Bacteria 1210
73 Ga0207705_10003995 3300025909 Bacteria 11221
74 Ga0207705_10005585 3300025909 Bacteria 9401
75 Ga0207705_10006865 3300025909 Bacteria 8414
76 Ga0207705_10099516 3300025909 Bacteria 2138
77 Ga0207705_10231283 3300025909 Bacteria 1406
78 Ga0207707_10149600 3300025912 Bacteria 2041
79 Ga0207660_10117583 3300025917 Bacteria 2010
80 Ga0207660_10231468 3300025917 Bacteria 1453
81 Ga0207657_10000968 3300025919 Bacteria 30447
82 Ga0207657_10062332 3300025919 Bacteria 3193
83 Ga0207657_10088418 3300025919 Bacteria 2590
84 Ga0207657_10088869 3300025919 Bacteria 2582
85 Ga0207657_10189095 3300025919 Unclassified 1662
86 Ga0207649_10012448 3300025920 Bacteria 4721
87 Ga0207649_10064954 3300025920 Bacteria 2309
88 Ga0207652_10039086 3300025921 Bacteria 4026
89 Ga0207652_10275282 3300025921 Unclassified 1518
90 Ga0207652_10307585 3300025921 Bacteria 1431
91 Ga0207694_10000007 3300025924 Bacteria 595422
92 Ga0207659_10377608 3300025926 Bacteria 1181
93 Ga0207690_10008150 3300025932 Bacteria 6218
94 Ga0207690_10167312 3300025932 Bacteria 1644
95 Ga0207691_10003930 3300025940 Bacteria 14438
96 Ga0207661_10072845 3300025944 Bacteria 2812
97 Ga0207679_10229465 3300025945 Bacteria 1566
98 Ga0207667_10000035 3300025949 Bacteria 301056
99 Ga0207667_10000138 3300025949 Bacteria 110270
100 Ga0207667_10375990 3300025949 Bacteria 1448
101 Ga0207640_10008845 3300025981 Bacteria 5607
102 Ga0207678_10031492 3300026067 Bacteria 4627
103 Ga0207641_10553777 3300026088 Bacteria 1122
104 Ga0207648_10328340 3300026089 Bacteria 1376
105 Ga0207674_10186705 3300026116 Bacteria 2023
106 Ga0207698_10002360 3300026142 Bacteria 11192
107 Ga0207698_10190087 3300026142 Unclassified 1828
108 Ga0207698_10218621 3300026142 Bacteria 1720
109 Ga0209969_1010881 3300027360 Unclassified 1304
110 Ga0209998_10002123 3300027717 Bacteria 4615
111 Ga0209974_10024286 3300027876 Unclassified 2006
112 Ga0268266_10311158 3300028379 Bacteria 1472
113 Ga0265334_10082792 3300028573 Unclassified 1180
114 Ga0265338_10000122 3300028800 Bacteria 142416
115 Ga0265332_10003268 3300031238 Bacteria 7877
116 Ga0265325_10003887 3300031241 Bacteria 9585
117 Ga0265339_10065629 3300031249 Bacteria 1945
118 Ga0265327_10020323 3300031251 Bacteria 4051
119 Ga0265316_10021879 3300031344 Bacteria 5406
120 Ga0307408_100038083 3300031548 Bacteria 3391
121 Ga0307408_100079365 3300031548 Bacteria 2449
122 Ga0265313_10000249 3300031595 Bacteria 58606
123 Ga0265342_10003971 3300031712 Bacteria 11847
124 Ga0307405_10114449 3300031731 Bacteria 1833
125 Ga0307413_10042777 3300031824 Unclassified 2664
126 Ga0307410_10002587 3300031852 Bacteria 8783
127 Ga0307410_10035696 3300031852 Bacteria 3231
128 Ga0307406_10035920 3300031901 Bacteria 3051
129 Ga0307406_10067526 3300031901 Unclassified 2331
130 Ga0307407_10027901 3300031903 Bacteria 3011
131 Ga0307407_10085829 3300031903 Bacteria 1916
132 Ga0307412_10028324 3300031911 Bacteria 3503
133 Ga0307412_10067252 3300031911 Unclassified 2432
134 Ga0307409_100012839 3300031995 Bacteria 5358
135 Ga0307409_100037491 3300031995 Bacteria 3574
136 Ga0307409_100083520 3300031995 Bacteria 2590
137 Ga0307409_100112892 3300031995 Bacteria 2283
138 Ga0307409_100579586 3300031995 Unclassified 1106
139 Ga0307409_100583230 3300031995 Bacteria 1102
140 Ga0307416_100003186 3300032002 Bacteria 9609
141 Ga0307416_100009313 3300032002 Bacteria 6421
142 Ga0307416_100221270 3300032002 Unclassified 1816
143 Ga0307416_100343859 3300032002 Bacteria 1506
144 Ga0307411_10001984 3300032005 Bacteria 8781
145 Ga0307411_10259665 3300032005 Unclassified 1371
146 Ga0307415_100002487 3300032126 Bacteria 9204
147 Ga0307415_100025601 3300032126 Bacteria 3706
148 Ga0307415_100094251 3300032126 Bacteria 2176
149 Ga0307415_100155550 3300032126 Bacteria 1765
150 Ga0395900_0368822 3300037418 Unclassified 1406
151 Ga0436364_0697604 3300037853 Bacteria 6873
152 Ga0436365_0905937 3300039437 Bacteria 6986
153 Ga0436361_0392451 3300039447 Bacteria 4280
154 Ga0466961_0009695 3300044693 Bacteria 6128
155 Ga0495620_0001882 3300046515 Bacteria 12343
156 Ga0501032_0038388 3300049569 Bacteria 3262
157 Ga0501038_0045434 3300049574 Bacteria 3813
158 Ga0501069_0047979 3300049585 Bacteria 2371
159 Ga0501202_002349 3300049652 Bacteria 3168
160 Ga0501206_003461 3300049653 Bacteria 2005
161 Ga0501217_000367 3300049661 Bacteria 7209
162 Ga0501230_001047 3300049667 Bacteria 3175
163 Ga0501233_004885 3300049668 Bacteria 2477
164 Ga0501235_000297 3300049669 Bacteria 9352
165 Ga0501249_003407 3300049679 Bacteria 3191
166 Ga0501259_001087 3300049688 Bacteria 4537
167 Ga0501261_001561 3300049690 Bacteria 2819
168 Ga0501225_0000968 3300049705 Bacteria 8991
169 Ga0501234_000809 3300049707 Bacteria 4909
170 Ga0501245_000809 3300049708 Bacteria 3910
171 Ga0501266_000622 3300049763 Bacteria 4604
172 Ga0501035_0116127 3300049822 Bacteria 2342
173 8055432106 8055431914 Bacteria 4551896
174 Ga0070679_100010800
175 MBSR1b_contig_2045597
176 MBSR1b_contig_6310168
177 JGI24737J22298_10017366
178 Ga0065712_10212009
179 Ga0065715_10123262
180 Ga0070658_10002245
181 Ga0070658_10007523
182 Ga0070658_10022137
183 Ga0070658_10078929
184 Ga0070658_10166271
185 Ga0070658_10181042
186 Ga0070658_10197570
187 Ga0070676_10110463
188 Ga0070683_100390802
189 Ga0070670_100005152
190 Ga0070680_100064173
191 Ga0070660_100023990
192 Ga0070660_100045562
193 Ga0070660_100089024
194 Ga0070661_100040514
195 Ga0070661_100317987
196 Ga0070692_10012342
197 Ga0070675_100026958
198 Ga0070671_100134043
199 Ga0070671_100177616
200 Ga0070671_100265502
201 Ga0070674_100147001
202 Ga0070673_100074513
203 Ga0070659_100138697
204 Ga0070714_100084302
205 Ga0070662_100070302
206 Ga0068867_100246380
207 Ga0070685_10002776
208 Ga0070685_10143471
209 Ga0070679_100323574
210 Ga0070684_100174705
211 Ga0070665_100112702
212 Ga0068855_100000029
213 Ga0068855_100002020
214 Ga0068855_100050008
215 Ga0068855_100102538
216 Ga0070664_100107935
217 Ga0068857_100098884
218 Ga0068854_100011737
219 Ga0068854_100067931
220 Ga0068856_100379766
221 Ga0068852_100008257
222 Ga0068852_100241973
223 Ga0068863_100813939
224 Ga0105240_10012767
225 Ga0105238_10000007
226 Ga0157373_10034638
227 Ga0157373_10154077
228 Ga0157373_10217346
229 Ga0157369_10024487
230 Ga0157369_10063663
231 Ga0157369_10236395
232 Ga0157372_10013360
233 Ga0157372_10016213
234 Ga0157372_10017078
235 Ga0157372_10066267
236 Ga0157372_10068873
237 Ga0157372_10160954
238 Ga0157372_10607672
239 Ga0157372_10750461
240 Ga0157375_10153201
241 Ga0213876_10165275
242 Ga0213875_10006237
243 Ga0207647_10062715
244 Ga0207647_10139732
245 Ga0207645_10234970
246 Ga0207705_10003995
247 Ga0207705_10005585
248 Ga0207705_10006865
249 Ga0207705_10099516
250 Ga0207705_10231283
251 Ga0207707_10149600
252 Ga0207660_10117583
253 Ga0207660_10231468
254 Ga0207657_10000968
255 Ga0207657_10062332
256 Ga0207657_10088418
257 Ga0207657_10088869
258 Ga0207657_10189095
259 Ga0207649_10012448
260 Ga0207649_10064954
261 Ga0207652_10039086
262 Ga0207652_10275282
263 Ga0207652_10307585
264 Ga0207694_10000007
265 Ga0207659_10377608
266 Ga0207690_10008150
267 Ga0207690_10167312
268 Ga0207691_10003930
269 Ga0207661_10072845
270 Ga0207679_10229465
271 Ga0207667_10000035
272 Ga0207667_10000138
273 Ga0207667_10375990
274 Ga0207640_10008845
275 Ga0207678_10031492
276 Ga0207641_10553777
277 Ga0207648_10328340
278 Ga0207674_10186705
279 Ga0207698_10002360
280 Ga0207698_10190087
281 Ga0207698_10218621
282 Ga0209969_1010881
283 Ga0209998_10002123
284 Ga0209974_10024286
285 Ga0268266_10311158
286 Ga0265334_10082792
287 Ga0265338_10000122
288 Ga0265332_10003268
289 Ga0265325_10003887
290 Ga0265339_10065629
291 Ga0265327_10020323
292 Ga0265316_10021879
293 Ga0307408_100038083
294 Ga0307408_100079365
295 Ga0265313_10000249
296 Ga0265342_10003971
297 Ga0307405_10114449
298 Ga0307413_10042777
299 Ga0307410_10002587
300 Ga0307410_10035696
301 Ga0307406_10035920
302 Ga0307406_10067526
303 Ga0307407_10027901
304 Ga0307407_10085829
305 Ga0307412_10028324
306 Ga0307412_10067252
307 Ga0307409_100012839
308 Ga0307409_100037491
309 Ga0307409_100083520
310 Ga0307409_100112892
311 Ga0307409_100579586
312 Ga0307409_100583230
313 Ga0307416_100003186
314 Ga0307416_100009313
315 Ga0307416_100221270
316 Ga0307416_100343859
317 Ga0307411_10001984
318 Ga0307411_10259665
319 Ga0307415_100002487
320 Ga0307415_100025601
321 Ga0307415_100094251
322 Ga0307415_100155550
323 Ga0395900_0368822
324 Ga0436364_0697604
325 Ga0436365_0905937
326 Ga0436361_0392451
327 Ga0466961_0009695
328 Ga0495620_0001882
329 Ga0501032_0038388
330 Ga0501038_0045434
331 Ga0501069_0047979
332 Ga0501202_002349
333 Ga0501206_003461
334 Ga0501217_000367
335 Ga0501230_001047
336 Ga0501233_004885
337 Ga0501235_000297
338 Ga0501249_003407
339 Ga0501259_001087
340 Ga0501261_001561
341 Ga0501225_0000968
342 Ga0501234_000809
343 Ga0501245_000809
344 Ga0501266_000622
345 Ga0501035_0116127
346 8055432106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01226

Form_Nir_trans

Formate/nitrite transporter

71

310

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3te2-assembly1.cif.gz_C crystal structure of hsc k16s 0.8983 44 290
3te1-assembly1.cif.gz_B crystal structure of hsc t84a 0.8808 44 295
7e26-assembly1.cif.gz_D structure of pffnt in apo state 0.8805 44 289
3tdo-assembly1.cif.gz_C crystal structure of hsc at ph 9.0 0.8804 44 295
3te0-assembly1.cif.gz_C crystal structure of hsc k148e 0.8784 44 295
ID Description Score Start End Superfamily
af_P37327_33_270_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9873 44 275 1.20.1080.10
af_P37327_33_270_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9586 44 275 1.20.1080.10
af_Q5A4N6_2_250_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9114 44 276 1.20.1080.10
af_Q2G1V0_12_273_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8938 46 287 1.20.1080.10
af_O77389_22_291_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8911 47 289 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A5B8SSD9-F1-model_v4 Formate/nitrite transporter family protein 0.9916 43 289 GO:0005886
GO:0015499
AF-A0A857GMK7-F1-model_v4 Formate transporter 0.989 44 289 GO:0005886
GO:0015499
AF-A0A101W4L3-F1-model_v4 Transporter (Formate/nitrite transporter family protein) 0.9871 44 289 GO:0005886
GO:0015499
AF-A0A1W6ZJH0-F1-model_v4 Formate transporter 0.9867 47 289 GO:0005886
GO:0015499
AF-A0A2G8C825-F1-model_v4 deleted 0.9863 44 289

Map