F261749

General Info

Members Datasets Scaffolds Average Seq Length
172 145 344 289

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8025478263|8025485834
Length 310
Sequence ETDSRVPGTDGSTPGTDNRPDGGAPALTVVRPGALTTVQDLGRPGHAHLGVGRSGALDRPAHALANRLVGNPPGRAALETTVDGCAVRTAAAVTVAVTGAPCPVRVDGRPVAWGAAVRVPAGAVLDVGRASWGLRSYVAFAGGLAVPPVLGSRSRDLLSGLGPEPLTAGAQLPLGAPCGPSTGADAVPWPGPPVGALVLPVVLGPRDDWFTPAALRTLAGGGFRVAAASNRIGLRTEGPALERAAEGELPSEGMVLGAVQVPPDGRPVVFLADHPTTGGYPVVGVVPEAELAAVAQAVPGTPVRFVPVRG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
6 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
7 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
8 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
9 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
10 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
11 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
12 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
13 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
14 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
15 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
16 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
17 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
18 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
19 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
20 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
21 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
22 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
23 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
24 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
25 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
26 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
27 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
28 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
29 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
30 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
31 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
32 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
33 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
34 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
35 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
36 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
37 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
38 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
39 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
40 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
41 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
42 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
43 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
44 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
45 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
46 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
47 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
48 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
49 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
50 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
51 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
52 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
53 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
54 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
55 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
56 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
57 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
58 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
59 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
60 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
61 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
62 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
63 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
64 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
65 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
66 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
67 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
68 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
69 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
70 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
71 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
72 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
73 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
74 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
75 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
76 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
77 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
86 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
89 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
90 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
91 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
92 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
93 2582580736 Prauserella sp. Am3 Isolate Unclassified
94 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
95 2643221548 Streptomyces sp. Root55 Isolate Unclassified
96 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
97 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
98 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
99 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
100 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
101 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
102 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
103 2808606448 Streptomyces sp. 193411 Isolate Unclassified
104 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
105 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
106 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
107 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
108 2862574272 Streptomyces sp. AcE210 Isolate Nodule
109 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
110 2867369537 Streptomyces sp. Z26 Isolate Unclassified
111 2867428634 Streptomyces sp. RP5T Isolate Unclassified
112 2867475112 Streptomyces sp. TM32 Isolate Unclassified
113 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
114 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
115 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
116 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
117 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
118 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
119 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
120 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
121 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
122 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
123 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
124 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
125 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
126 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
127 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
128 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
129 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
130 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
131 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
132 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
133 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
134 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
135 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
136 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
137 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
138 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
139 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
140 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
141 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
142 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
143 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
144 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
145 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 67.44
Metatranscriptomes 0.58
Isolates 31.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.07
Nodule 0.58
Rhizoplane 0.58
Rhizosphere 80.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10122324 3300003320 Bacteria 1902
2 rootL2_10033936 3300003322 Bacteria 7201
3 JGI25160J50197_1007648 3300003354 Bacteria 4208
4 JGI25160J50197_1027074 3300003354 Bacteria 1567
5 Ga0006562J51391_1084838 3300003578 Bacteria 5280
6 Ga0068858_100606681 3300005842 Bacteria 1062
7 Ga0105246_10039933 3300011119 Bacteria 3164
8 Ga0209758_1008099 3300025297 Bacteria 6925
9 Ga0207426_1002407 3300025302 Bacteria 12039
10 Ga0207426_1003297 3300025302 Bacteria 8982
11 Ga0207426_1012826 3300025302 Bacteria 3132
12 Ga0207702_10366057 3300026078 Bacteria 1383
13 Ga0265340_10000834 3300031247 Bacteria 17534
14 Ga0307513_10172526 3300031456 Bacteria 2038
15 Ga0307508_10013020 3300031616 Bacteria 7607
16 Ga0307508_10217904 3300031616 Bacteria 1509
17 Ga0307514_10033166 3300031649 Bacteria 4122
18 Ga0307507_10069137 3300033179 Bacteria 3216
19 Ga0395898_0003770 3300037466 Bacteria 16776
20 Ga0395901_0409132 3300038443 Bacteria 1393
21 Ga0439436_0003644 3300041404 Bacteria 4694
22 Ga0439449_0001695 3300042007 Bacteria 8674
23 Ga0439450_017412 3300042008 Bacteria 1498
24 Ga0439457_001044 3300042014 Bacteria 8376
25 Ga0450903_000157 3300042138 Bacteria 14910
26 Ga0439458_0000372 3300042157 Bacteria 11313
27 Ga0466969_0050543 3300044656 Bacteria 2049
28 Ga0466972_0003178 3300044658 Bacteria 8161
29 Ga0466972_0023178 3300044658 Bacteria 3089
30 Ga0466965_0000492 3300044683 Bacteria 14023
31 Ga0466966_0002754 3300044684 Bacteria 11547
32 Ga0466961_0011622 3300044693 Bacteria 5626
33 Ga0466961_0097579 3300044693 Bacteria 1853
34 Ga0466963_0000319 3300044694 Bacteria 21690
35 Ga0466963_0000336 3300044694 Bacteria 21334
36 Ga0466971_0000247 3300044719 Bacteria 20764
37 Ga0466968_0070812 3300044735 Bacteria 1518
38 Ga0466970_0000625 3300044765 Bacteria 17367
39 Ga0466970_0000983 3300044765 Bacteria 13708
40 Ga0466957_0000837 3300044842 Bacteria 15736
41 Ga0466959_0019238 3300045049 Bacteria 5020
42 Ga0466958_0001544 3300045836 Bacteria 11027
43 Ga0466967_0001364 3300045976 Bacteria 14054
44 Ga0495617_056498 3300046452 Bacteria 1301
45 Ga0495592_0101632 3300046454 Bacteria 2048
46 Ga0495603_0001803 3300046455 Bacteria 12639
47 Ga0495629_0006080 3300046459 Bacteria 8969
48 Ga0495638_0030975 3300046460 Bacteria 3440
49 Ga0495651_0024492 3300046462 Bacteria 4695
50 Ga0495582_0049084 3300046473 Bacteria 2324
51 Ga0495639_0003330 3300046475 Bacteria 6964
52 Ga0495662_0002185 3300046476 Bacteria 9837
53 Ga0495664_0003293 3300046477 Bacteria 8786
54 Ga0495607_0021331 3300046501 Bacteria 4077
55 Ga0495583_0009607 3300046506 Bacteria 5760
56 Ga0495606_0134723 3300046507 Bacteria 1464
57 Ga0495628_0063747 3300046516 Bacteria 2887
58 Ga0495628_0161013 3300046516 Bacteria 1705
59 Ga0495630_0003347 3300046517 Bacteria 11165
60 Ga0495643_0004652 3300046522 Bacteria 9535
61 Ga0495648_0076886 3300046524 Bacteria 1915
62 Ga0495642_0127781 3300046528 Bacteria 1093
63 Ga0495640_0050427 3300046533 Bacteria 2867
64 Ga0495587_0018037 3300046536 Bacteria 4375
65 Ga0495609_0094013 3300046538 Bacteria 1302
66 Ga0495622_0027208 3300046557 Bacteria 2669
67 Ga0495634_0008868 3300046642 Bacteria 7455
68 Ga0495635_0016099 3300046663 Bacteria 5222
69 Ga0495657_0001338 3300046675 Bacteria 21439
70 Ga0495657_0013235 3300046675 Bacteria 6093
71 Ga0495623_0048045 3300046679 Bacteria 2708
72 Ga0495646_0017985 3300046680 Bacteria 4478
73 Ga0495658_0006034 3300046683 Bacteria 5950
74 Ga0495613_0001802 3300046689 Bacteria 16281
75 Ga0495613_0107481 3300046689 Bacteria 2012
76 Ga0495613_0138023 3300046689 Bacteria 1743
77 Ga0495649_0159050 3300046694 Bacteria 1185
78 Ga0495600_0000502 3300046809 Bacteria 20307
79 Ga0495604_0001218 3300047317 Bacteria 21129
80 Ga0495674_0060737 3300047319 Bacteria 3297
81 Ga0495676_0008726 3300047321 Bacteria 9277
82 Ga0495676_0015891 3300047321 Bacteria 6689
83 Ga0495687_027333 3300047443 Bacteria 2671
84 Ga0495675_0167028 3300047444 Bacteria 1353
85 Ga0495677_0046496 3300047445 Bacteria 1593
86 Ga0495685_004663 3300047447 Bacteria 4446
87 Ga0495685_011963 3300047447 Bacteria 2935
88 Ga0495684_0087247 3300047471 Bacteria 2365
89 Ga0495593_0009905 3300047673 Bacteria 5526
90 Ga0495602_0018583 3300048088 Bacteria 6934
91 Ga0501031_0011892 3300049568 Bacteria 5674
92 Ga0501032_0013998 3300049569 Bacteria 5691
93 Ga0501032_0069807 3300049569 Bacteria 2344
94 Ga0501033_0001630 3300049570 Bacteria 19706
95 Ga0501033_0028104 3300049570 Bacteria 4227
96 Ga0501033_0119119 3300049570 Bacteria 1917
97 Ga0501033_0264614 3300049570 Bacteria 1216
98 Ga0501034_0125118 3300049571 Bacteria 2556
99 Ga0501034_0190486 3300049571 Bacteria 2013
100 Ga0501034_0236518 3300049571 Bacteria 1774
101 Ga0501038_0004790 3300049574 Bacteria 12574
102 Ga0501038_0139629 3300049574 Bacteria 1983
103 Ga0501043_0034189 3300049579 Bacteria 3998
104 Ga0501043_0035103 3300049579 Bacteria 3945
105 Ga0501043_0138658 3300049579 Bacteria 1905
106 Ga0501046_0355536 3300049580 Bacteria 1063
107 Ga0501047_0025720 3300049581 Bacteria 5660
108 Ga0501070_0008714 3300049586 Bacteria 8577
109 Ga0501035_0003092 3300049822 Bacteria 15982
110 Ga0501035_0190728 3300049822 Bacteria 1762
111 Ga0501044_0037190 3300049823 Bacteria 5089
112 Ga0501044_0038635 3300049823 Bacteria 4984
113 Ga0501044_0520533 3300049823 Bacteria 1089
114 Ga0501045_0214180 3300049824 Bacteria 1435
115 nmdc:mga04h51_3624_c1 3300050495 Bacteria 3772
116 Ga0466962_0001430 3300061719 Bacteria 11124
117 Ga0466962_0050852 3300061719 Bacteria 1981
118 8025485834 8025478263 Bacteria 8209203
119 2547409782 2547132111 Bacteria 8013147
120 2583152325 2582580736 Bacteria 5325865
121 2585303430 2582581313 Bacteria 10042643
122 2643764999 2643221548 Bacteria 8053412
123 2644461161 2643221682 Bacteria 6743283
124 2753069676 2751185734 Bacteria 8863695
125 2784592621 2784132148 Bacteria 8627943
126 2785345830 2784746763 Bacteria 9783172
127 2785367057 2784746768 Bacteria 10036182
128 2786668096 2786546132 Bacteria 10419719
129 2793981367 2791355406 Bacteria 11364898
130 2809236257 2808606448 Bacteria 8656184
131 2812360405 2811994879 Bacteria 9313447
132 2812482505 2811994917 Bacteria 7761064
133 2852637624 2852635781 Bacteria 8251373
134 2862186347 2862178590 Bacteria 8583590
135 2862583810 2862574272 Bacteria 10567477
136 2863407063 2863404153 Bacteria 9672205
137 2867370132 2867369537 Bacteria 6501581
138 2867428654 2867428634 Bacteria 9590268
139 2867479851 2867475112 Bacteria 6909112
140 2870727817 2870721527 Bacteria 9689237
141 2873157765 2873151551 Bacteria 8625867
142 2912722595 2912715099 Bacteria 9460473
143 2912726282 2912723979 Bacteria 8557534
144 2918502427 2918501144 Bacteria 8668083
145 2919472283 2919468124 Bacteria 9133025
146 2946065484 2946064051 Bacteria 8957905
147 2947231926 2947224130 Bacteria 9938529
148 2954388740 2954380949 Bacteria 10050426
149 2954674384 2954673503 Bacteria 9685905
150 2954689747 2954682443 Bacteria 9862841
151 2954699530 2954691527 Bacteria 10720516
152 2954702688 2954701450 Bacteria 10834262
153 2954718469 2954711539 Bacteria 10867210
154 2954728439 2954721474 Bacteria 10456478
155 2954733370 2954731030 Bacteria 10243860
156 2954747335 2954740390 Bacteria 10229294
157 2954752253 2954749733 Bacteria 10366972
158 2954766451 2954759201 Bacteria 9358192
159 2997459548 2997451912 Bacteria 8492419
160 2997605955 2997600082 Bacteria 9896405
161 3006500584 3006493962 Bacteria 8825450
162 8001788086 8001781756 Bacteria 9586736
163 8008580839 8008574985 Bacteria 7815457
164 8047901162 8047893842 Bacteria 11723082
165 8048134223 8048127548 Bacteria 11053136
166 8048357739 8048356638 Bacteria 11044339
167 8048378101 8048369669 Bacteria 11666822
168 8048387199 8048379754 Bacteria 11877923
169 8048408076 8048406513 Bacteria 8936924
170 8054162004 8054160619 Bacteria 7783213
171 8056452183 8056447290 Bacteria 7680491
172 8056668326 8056667051 Bacteria 6953971
173 rootH2_10122324
174 rootL2_10033936
175 JGI25160J50197_1007648
176 JGI25160J50197_1027074
177 Ga0006562J51391_1084838
178 Ga0068858_100606681
179 Ga0105246_10039933
180 Ga0209758_1008099
181 Ga0207426_1002407
182 Ga0207426_1003297
183 Ga0207426_1012826
184 Ga0207702_10366057
185 Ga0265340_10000834
186 Ga0307513_10172526
187 Ga0307508_10013020
188 Ga0307508_10217904
189 Ga0307514_10033166
190 Ga0307507_10069137
191 Ga0395898_0003770
192 Ga0395901_0409132
193 Ga0439436_0003644
194 Ga0439449_0001695
195 Ga0439450_017412
196 Ga0439457_001044
197 Ga0450903_000157
198 Ga0439458_0000372
199 Ga0466969_0050543
200 Ga0466972_0003178
201 Ga0466972_0023178
202 Ga0466965_0000492
203 Ga0466966_0002754
204 Ga0466961_0011622
205 Ga0466961_0097579
206 Ga0466963_0000319
207 Ga0466963_0000336
208 Ga0466971_0000247
209 Ga0466968_0070812
210 Ga0466970_0000625
211 Ga0466970_0000983
212 Ga0466957_0000837
213 Ga0466959_0019238
214 Ga0466958_0001544
215 Ga0466967_0001364
216 Ga0495617_056498
217 Ga0495592_0101632
218 Ga0495603_0001803
219 Ga0495629_0006080
220 Ga0495638_0030975
221 Ga0495651_0024492
222 Ga0495582_0049084
223 Ga0495639_0003330
224 Ga0495662_0002185
225 Ga0495664_0003293
226 Ga0495607_0021331
227 Ga0495583_0009607
228 Ga0495606_0134723
229 Ga0495628_0063747
230 Ga0495628_0161013
231 Ga0495630_0003347
232 Ga0495643_0004652
233 Ga0495648_0076886
234 Ga0495642_0127781
235 Ga0495640_0050427
236 Ga0495587_0018037
237 Ga0495609_0094013
238 Ga0495622_0027208
239 Ga0495634_0008868
240 Ga0495635_0016099
241 Ga0495657_0001338
242 Ga0495657_0013235
243 Ga0495623_0048045
244 Ga0495646_0017985
245 Ga0495658_0006034
246 Ga0495613_0001802
247 Ga0495613_0107481
248 Ga0495613_0138023
249 Ga0495649_0159050
250 Ga0495600_0000502
251 Ga0495604_0001218
252 Ga0495674_0060737
253 Ga0495676_0008726
254 Ga0495676_0015891
255 Ga0495687_027333
256 Ga0495675_0167028
257 Ga0495677_0046496
258 Ga0495685_004663
259 Ga0495685_011963
260 Ga0495684_0087247
261 Ga0495593_0009905
262 Ga0495602_0018583
263 Ga0501031_0011892
264 Ga0501032_0013998
265 Ga0501032_0069807
266 Ga0501033_0001630
267 Ga0501033_0028104
268 Ga0501033_0119119
269 Ga0501033_0264614
270 Ga0501034_0125118
271 Ga0501034_0190486
272 Ga0501034_0236518
273 Ga0501038_0004790
274 Ga0501038_0139629
275 Ga0501043_0034189
276 Ga0501043_0035103
277 Ga0501043_0138658
278 Ga0501046_0355536
279 Ga0501047_0025720
280 Ga0501070_0008714
281 Ga0501035_0003092
282 Ga0501035_0190728
283 Ga0501044_0037190
284 Ga0501044_0038635
285 Ga0501044_0520533
286 Ga0501045_0214180
287 nmdc:mga04h51_3624_c1
288 Ga0466962_0001430
289 Ga0466962_0050852
290 8025485834
291 2547409782
292 2583152325
293 2585303430
294 2643764999
295 2644461161
296 2753069676
297 2784592621
298 2785345830
299 2785367057
300 2786668096
301 2793981367
302 2809236257
303 2812360405
304 2812482505
305 2852637624
306 2862186347
307 2862583810
308 2863407063
309 2867370132
310 2867428654
311 2867479851
312 2870727817
313 2873157765
314 2912722595
315 2912726282
316 2918502427
317 2919472283
318 2946065484
319 2947231926
320 2954388740
321 2954674384
322 2954689747
323 2954699530
324 2954702688
325 2954718469
326 2954728439
327 2954733370
328 2954747335
329 2954752253
330 2954766451
331 2997459548
332 2997605955
333 3006500584
334 8001788086
335 8008580839
336 8047901162
337 8048134223
338 8048357739
339 8048378101
340 8048387199
341 8048408076
342 8054162004
343 8056452183
344 8056668326

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02626

CT_A_B

Carboxyltransferase domain, subdomain A and B

49

307

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mml-assembly2.cif.gz_E allophanate hydrolase complex from mycobacterium smegmatis, msmeg0435-msmeg0436 0.8709 4 277
5i8i-assembly2.cif.gz_D crystal structure of the k. lactis urea amidolyase 0.8649 5 275
3mml-assembly2.cif.gz_E allophanate hydrolase complex from mycobacterium smegmatis, msmeg0435-msmeg0436 0.8593 4 277
3oep-assembly1.cif.gz_A crystal structure of ttha0988 in space group p43212 0.8542 4 272
3opf-assembly1.cif.gz_A crystal structure of ttha0988 in space group p212121 0.8526 4 272
ID Description Score Start End Superfamily
af_Q2FXW9_143_281_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9315 162 276 2.40.100.10
af_Q2G094_189_326_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9307 162 274 2.40.100.10
5dudA02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9289 163 275 2.40.100.10
3mmlG02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9077 164 277 2.40.100.10
3va7A04 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8787 164 276 2.40.100.10
ID Description Score Start End GO Terms
AF-S3ZAQ2-F1-model_v4 Putative KipI antagonist 0.9645 168 275 GO:0005524
GO:0016787
AF-A0A6G3W610-F1-model_v4 Biotin-dependent carboxyltransferase family protein 0.9638 155 277 GO:0005524
GO:0016740
GO:0016787
AF-V6UAE7-F1-model_v4 deleted 0.9637 165 274
AF-A0A066YTC5-F1-model_v4 Carboxyltransferase domain-containing protein 0.9553 165 274 GO:0005524
GO:0016787
AF-A0A6N9UC03-F1-model_v4 Biotin-dependent carboxyltransferase family protein 0.951 155 274 GO:0005524
GO:0016740
GO:0016787

Map