F261700

General Info

Members Datasets Scaffolds Average Seq Length
172 136 121 311

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2847686936|2847689580
Length 367
Sequence SRPEFHDEAKAFEHVESILWPNGPVCPKCGSVDRHYALKGVRTKPSKKNPNGVERHGLYKCSACRSQFTVRMGTIFEESHLPLTKWLQAIHLMCASKKGISAHQMHRILECTYEAAWFLCHRIRLAMASGELSPMGGGGSAVEVDETYIGRLKGAPVKPGGGAHKNTVVTLVERGGKARSFHVDTARMGNVMPIVRANIAKESALMTDESGIYRRAGQDFASHEFVTHSKDEYVRGNVHTNTVEGFFSIFKRGMKGVYQHCSEHHLHRYLAEFDFRYSNRIALGVDDGTRAFIALNGVGQAPHLSQTCLTISGGTTASRRSSNCRSGNMHANARKSRGSSPRHRLLTNPWRLPGVFDSLGHVEATRP

Samples

Sample ID Description Type Environment
1 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
4 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
5 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
6 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
7 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
8 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
9 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
10 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
11 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
12 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
13 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
14 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
15 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
16 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
17 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
18 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
19 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
20 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
21 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
22 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
23 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
24 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
25 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
26 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
27 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
28 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
29 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
30 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
31 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
32 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
33 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
34 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
35 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
36 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
37 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
38 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
39 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
40 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
41 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
42 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
43 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
44 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
45 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
46 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
47 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
48 3004167301 Mesorhizobium loti 582 Isolate Unclassified
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
90 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
131 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
132 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
133 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
136 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.35
Metatranscriptomes 0
Isolates 29.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.72
Nodule 24.42
Rhizoplane 0.58
Rhizosphere 59.3
Stem 0
Stem Tuber 0
Unclassified 6.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10410081 3300005327 Bacteria 1164
2 Ga0070660_100389289 3300005339 Bacteria 1151
3 Ga0070668_100110408 3300005347 Bacteria 2188
4 Ga0070667_100002292 3300005367 Bacteria 16846
5 Ga0070714_100583989 3300005435 Bacteria 1072
6 Ga0070711_100456243 3300005439 Unclassified 1047
7 Ga0070698_100004357 3300005471 Bacteria 15558
8 Ga0070679_100027466 3300005530 Bacteria 5602
9 Ga0070679_100062149 3300005530 Bacteria 3723
10 Ga0070697_100044356 3300005536 Bacteria 3601
11 Ga0070695_100111888 3300005545 Bacteria 1854
12 Ga0068864_100002427 3300005618 Bacteria 15409
13 Ga0068862_100130147 3300005844 Bacteria 2225
14 Ga0081455_10001924 3300005937 Bacteria 24940
15 Ga0081455_10016474 3300005937 Bacteria 7134
16 Ga0081540_1026218 3300005983 Bacteria 3332
17 Ga0081539_10017200 3300005985 Bacteria 5091
18 Ga0075365_10202150 3300006038 Bacteria 1392
19 Ga0075365_10206470 3300006038 Bacteria 1377
20 Ga0075367_10021796 3300006178 Bacteria 3586
21 Ga0075367_10023592 3300006178 Unclassified 3464
22 Ga0075434_100019642 3300006871 Bacteria 6539
23 Ga0075434_100623063 3300006871 Unclassified 1098
24 Ga0075429_100311771 3300006880 Unclassified 1377
25 Ga0105248_10319167 3300009177 Bacteria 1750
26 Ga0105238_10086332 3300009551 Bacteria 3126
27 Ga0105249_10000418 3300009553 Bacteria 40530
28 Ga0105249_10001922 3300009553 Bacteria 18026
29 Ga0157370_10045920 3300013104 Bacteria 4190
30 Ga0157369_10026549 3300013105 Bacteria 6423
31 Ga0163163_10412217 3300014325 Bacteria 1410
32 Ga0157379_10065273 3300014968 Bacteria 3254
33 Ga0213875_10001057 3300021388 Bacteria 19363
34 Ga0209130_1031661 3300025284 Bacteria 1083
35 Ga0207705_10481590 3300025909 Bacteria 963
36 Ga0207693_10255667 3300025915 Unclassified 1374
37 Ga0207657_10360999 3300025919 Bacteria 1145
38 Ga0207652_10000474 3300025921 Bacteria 41182
39 Ga0207652_10013752 3300025921 Bacteria 6545
40 Ga0207652_10167039 3300025921 Bacteria 1973
41 Ga0207652_10385477 3300025921 Bacteria 1265
42 Ga0207712_10000642 3300025961 Bacteria 27370
43 Ga0207712_10001557 3300025961 Bacteria 15452
44 Ga0207668_10090734 3300025972 Bacteria 2243
45 Ga0207658_10001514 3300025986 Bacteria 18049
46 Ga0207698_10005222 3300026142 Bacteria 7987
47 Ga0209813_10003338 3300027866 Bacteria 3747
48 Ga0268265_10126884 3300028380 Bacteria 2113
49 Ga0268265_10350793 3300028380 Bacteria 1347
50 Ga0307515_10105669 3300028794 Bacteria 3349
51 Ga0265338_10002416 3300028800 Bacteria 28094
52 Ga0265338_10034414 3300028800 Bacteria 4896
53 Ga0265328_10075163 3300031239 Bacteria 1243
54 Ga0265340_10029359 3300031247 Bacteria 2762
55 Ga0307513_10000203 3300031456 Bacteria 85712
56 Ga0373941_0000099 3300035115 Bacteria 14313
57 Ga0373933_0000528 3300035724 Bacteria 23806
58 Ga0395899_0012696 3300037312 Bacteria 6456
59 Ga0395899_0042342 3300037312 Bacteria 3400
60 Ga0395900_0057993 3300037418 Bacteria 3986
61 Ga0395900_0064594 3300037418 Bacteria 3761
62 Ga0395900_0164496 3300037418 Bacteria 2261
63 Ga0395900_0363866 3300037418 Bacteria 1417
64 Ga0395898_0006761 3300037466 Bacteria 12215
65 Ga0395898_0051097 3300037466 Bacteria 4043
66 Ga0395898_0069962 3300037466 Bacteria 3394
67 Ga0395898_0120959 3300037466 Bacteria 2508
68 Ga0395905_0034717 3300037471 Bacteria 4736
69 Ga0395905_0317085 3300037471 Bacteria 1448
70 Ga0436364_0461180 3300037853 Bacteria 9732
71 Ga0395901_0075870 3300038443 Bacteria 3507
72 Ga0395901_0233016 3300038443 Bacteria 1922
73 Ga0395901_0397379 3300038443 Bacteria 1416
74 Ga0395901_0509561 3300038443 Bacteria 1224
75 Ga0495669_0000001 3300046684 Bacteria 291866
76 Ga0495604_0003613 3300047317 Bacteria 12328
77 Ga0495672_0005192 3300047320 Bacteria 10379
78 Ga0495677_0019296 3300047445 Bacteria 2473
79 Ga0496105_0021868 3300048908 Bacteria 5177
80 Ga0501032_0000320 3300049569 Bacteria 40199
81 Ga0501033_0002095 3300049570 Bacteria 17296
82 Ga0501034_0000250 3300049571 Bacteria 99407
83 Ga0501036_0000956 3300049572 Bacteria 21753
84 Ga0501037_0000092 3300049573 Bacteria 83924
85 Ga0501038_0000059 3300049574 Bacteria 92319
86 Ga0501039_0000547 3300049575 Bacteria 27186
87 Ga0501043_0001821 3300049579 Bacteria 18302
88 Ga0501046_0003991 3300049580 Bacteria 13473
89 Ga0501046_0038298 3300049580 Bacteria 3849
90 Ga0501047_0000022 3300049581 Bacteria 249062
91 Ga0501048_0000821 3300049582 Bacteria 22904
92 Ga0501067_0000931 3300049583 Bacteria 15697
93 Ga0501069_0027457 3300049585 Bacteria 3119
94 Ga0501069_0029926 3300049585 Bacteria 2989
95 Ga0501070_0002047 3300049586 Bacteria 17725
96 Ga0501070_0073855 3300049586 Bacteria 2822
97 Ga0501070_0328464 3300049586 Bacteria 1243
98 Ga0501071_0280598 3300049587 Bacteria 1261
99 Ga0501073_0004115 3300049589 Bacteria 10914
100 Ga0501074_0000680 3300049590 Bacteria 21267
101 Ga0501233_001705 3300049668 Bacteria 3783
102 Ga0501079_0032654 3300049741 Bacteria 4003
103 Ga0501080_0009761 3300049742 Bacteria 8769
104 Ga0501080_0337592 3300049742 Bacteria 1362
105 Ga0501035_0000240 3300049822 Bacteria 65635
106 Ga0501035_0226582 3300049822 Bacteria 1594
107 Ga0501044_0000072 3300049823 Bacteria 124143
108 Ga0501044_0283081 3300049823 Bacteria 1591
109 Ga0501044_0401967 3300049823 Bacteria 1282
110 Ga0501044_0517593 3300049823 Bacteria 1093
111 nmdc:mga0yw44_238169_c1 3300050492 Bacteria 1209
112 nmdc:mga06z11_3745_c1 3300050494 Bacteria 5910
113 nmdc:mga06z11_822_c1 3300050494 Bacteria 11360
114 nmdc:mga0n895_137572_c1 3300050512 Unclassified 2470
115 Ga0500568_0051533 3300053139 Bacteria 1619
116 Ga0500616_0000001 3300053153 Bacteria 1986011
117 Ga0500616_0010522 3300053153 Bacteria 5531
118 Ga0500616_0138856 3300053153 Bacteria 1138
119 Ga0500620_014699 3300053155 Bacteria 2193
120 Ga0500599_000546 3300053736 Bacteria 3960
121 Ga0501082_0121074 3300060353 Bacteria 2268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025909 Ga0207705_10481590 Ga0207705_104815901 252
2 3300050492 nmdc:mga0yw44_238169_c1 nmdc:mga0yw44_238169_c1_347_1165 258
3 3300013104 Ga0157370_10045920 Ga0157370_100459205 261
4 iso_pu_bacteria 2878738818 2878742191 262
5 iso_pu_bacteria 2924776078 2924779875 262
6 iso_pu_bacteria 2937877337 2937877890 277
7 iso_pu_bacteria 2958084443 2958085001 277
8 3300053155 Ga0500620_014699 Ga0500620_014699_1249_2130 278
9 3300037312 Ga0395899_0042342 Ga0395899_0042342_2383_3297 290
10 3300037418 Ga0395900_0057993 Ga0395900_0057993_2395_3309 290
11 3300037418 Ga0395900_0064594 Ga0395900_0064594_2331_3242 290
12 3300037466 Ga0395898_0006761 Ga0395898_0006761_9186_10097 290
13 3300037466 Ga0395898_0051097 Ga0395898_0051097_2532_3446 290
14 3300037471 Ga0395905_0317085 Ga0395905_0317085_370_1281 290
15 3300038443 Ga0395901_0075870 Ga0395901_0075870_2406_3320 290
16 3300038443 Ga0395901_0509561 Ga0395901_0509561_150_1061 290
17 3300047317 Ga0495604_0003613 Ga0495604_0003613_11008_12003 290
18 3300037418 Ga0395900_0363866 Ga0395900_0363866_159_1097 291
19 iso_pu_bacteria 2856314179 2856319899 292
20 iso_pu_bacteria 2906414383 2906420675 292
21 iso_pu_bacteria 2509276022 2509393129 294
22 iso_pu_bacteria 2878753008 2878755360 294
23 iso_pu_bacteria 2977821940 2977824500 294
24 iso_pu_bacteria 8004374579 8004376940 294
25 3300025284 Ga0209130_1031661 Ga0209130_10316611 295
26 iso_pu_bacteria 2643221627 2644156226 295
27 iso_pu_bacteria 2847670302 2847673073 295
28 iso_pu_bacteria 2874168670 2874171906 295
29 iso_pu_bacteria 2882912400 2882914108 295
30 iso_pu_bacteria 2903492973 2903499160 295
31 iso_pu_bacteria 2958064165 2958068141 295
32 iso_pu_bacteria 2961127735 2961131045 295
33 iso_pu_bacteria 2967996073 2968001292 295
34 iso_pu_bacteria 2968003550 2968007345 295
35 iso_pu_bacteria 2970524798 2970525654 295
36 iso_pu_bacteria 2906354277 2906357119 296
37 iso_pu_bacteria 2922185730 2922189605 296
38 iso_pu_bacteria 2924718760 2924722226 296
39 iso_pu_bacteria 2937843397 2937843576 296
40 iso_pu_bacteria 2977971508 2977977446 296
41 3300006880 Ga0075429_100311771 Ga0075429_1003117712 297
42 3300049586 Ga0501070_0328464 Ga0501070_0328464_178_1095 297
43 3300049742 Ga0501080_0337592 Ga0501080_0337592_154_1071 297
44 iso_pu_bacteria 2844009547 2844010294 297
45 iso_pu_bacteria 2847686936 2847689580 297
46 iso_pu_bacteria 2937848649 2937854798 297
47 iso_pu_bacteria 2958115193 2958119533 297
48 iso_pu_bacteria 2958144490 2958147766 297
49 iso_pu_bacteria 2968097103 2968100549 297
50 iso_pu_bacteria 2970503327 2970504951 297
51 iso_pu_bacteria 2977922695 2977925990 297
52 iso_pu_bacteria 2979779861 2979783266 297
53 iso_pu_bacteria 2979808191 2979809589 297
54 iso_pu_bacteria 8004703790 8004707118 297
55 3300005937 Ga0081455_10016474 Ga0081455_100164743 298
56 iso_pu_bacteria 2513237351 2514586476 298
57 3300005439 Ga0070711_100456243 Ga0070711_1004562431 299
58 3300005536 Ga0070697_100044356 Ga0070697_1000443562 299
59 3300005545 Ga0070695_100111888 Ga0070695_1001118881 299
60 3300005937 Ga0081455_10001924 Ga0081455_100019247 299
61 3300006038 Ga0075365_10202150 Ga0075365_102021502 299
62 3300035724 Ga0373933_0000528 Ga0373933_0000528_20234_21136 299
63 iso_pu_bacteria 2513237096 2513658783 299
64 iso_pu_bacteria 2513237145 2513921047 299
65 iso_pu_bacteria 2524023209 2524457998 299
66 iso_pu_bacteria 2842298080 2842299820 299
67 iso_pu_bacteria 2842357229 2842359658 299
68 iso_pu_bacteria 2871451962 2871458539 299
69 iso_pu_bacteria 2871474448 2871476029 299
70 iso_pu_bacteria 2881161766 2881163202 299
71 iso_pu_bacteria 2882632389 2882634917 299
72 iso_pu_bacteria 2903448605 2903454497 299
73 iso_pu_bacteria 2958071322 2958072836 299
74 iso_pu_bacteria 2968083720 2968088838 299
75 iso_pu_bacteria 2977922695 2977922838 299
76 iso_pu_bacteria 3004167301 3004172699 299
77 3300005844 Ga0068862_100130147 Ga0068862_1001301472 300
78 3300014325 Ga0163163_10412217 Ga0163163_104122171 300
79 3300025921 Ga0207652_10385477 Ga0207652_103854772 300
80 3300049580 Ga0501046_0038298 Ga0501046_0038298_2306_3253 300
81 3300005339 Ga0070660_100389289 Ga0070660_1003892891 301
82 3300025919 Ga0207657_10360999 Ga0207657_103609991 301
83 3300025921 Ga0207652_10013752 Ga0207652_100137523 301
84 3300049585 Ga0501069_0029926 Ga0501069_0029926_1866_2828 301
85 3300049586 Ga0501070_0073855 Ga0501070_0073855_1700_2638 301
86 3300049822 Ga0501035_0226582 Ga0501035_0226582_370_1332 301
87 3300049823 Ga0501044_0401967 Ga0501044_0401967_180_1157 301
88 3300049823 Ga0501044_0517593 Ga0501044_0517593_66_1010 301
89 3300005347 Ga0070668_100110408 Ga0070668_1001104082 302
90 3300005367 Ga0070667_100002292 Ga0070667_1000022923 302
91 3300009551 Ga0105238_10086332 Ga0105238_100863324 302
92 3300009553 Ga0105249_10000418 Ga0105249_1000041842 302
93 3300013105 Ga0157369_10026549 Ga0157369_100265495 302
94 3300025961 Ga0207712_10001557 Ga0207712_100015578 302
95 3300025972 Ga0207668_10090734 Ga0207668_100907343 302
96 3300028380 Ga0268265_10126884 Ga0268265_101268841 302
97 3300031239 Ga0265328_10075163 Ga0265328_100751631 302
98 3300037471 Ga0395905_0034717 Ga0395905_0034717_3470_4429 302
99 3300053153 Ga0500616_0010522 Ga0500616_0010522_146_1114 302
100 3300005435 Ga0070714_100583989 Ga0070714_1005839891 303
101 3300005530 Ga0070679_100062149 Ga0070679_1000621492 303
102 3300005985 Ga0081539_10017200 Ga0081539_100172007 303
103 3300009177 Ga0105248_10319167 Ga0105248_103191671 303
104 3300014968 Ga0157379_10065273 Ga0157379_100652731 303
105 3300025921 Ga0207652_10167039 Ga0207652_101670392 303
106 3300031456 Ga0307513_10000203 Ga0307513_1000020378 303
107 3300035115 Ga0373941_0000099 Ga0373941_0000099_1784_2740 303
108 3300037466 Ga0395898_0069962 Ga0395898_0069962_449_1402 303
109 3300038443 Ga0395901_0233016 Ga0395901_0233016_600_1553 303
110 3300046684 Ga0495669_0000001 Ga0495669_0000001_21330_22277 303
111 3300047445 Ga0495677_0019296 Ga0495677_0019296_1039_1986 303
112 3300049587 Ga0501071_0280598 Ga0501071_0280598_279_1196 303
113 3300053139 Ga0500568_0051533 Ga0500568_0051533_504_1460 303
114 3300053153 Ga0500616_0000001 Ga0500616_0000001_1184608_1185552 303
115 3300053153 Ga0500616_0138856 Ga0500616_0138856_64_1008 303
116 3300053736 Ga0500599_000546 Ga0500599_000546_2507_3454 303
117 3300005530 Ga0070679_100027466 Ga0070679_1000274661 304
118 3300005983 Ga0081540_1026218 Ga0081540_10262182 304
119 3300006038 Ga0075365_10206470 Ga0075365_102064702 304
120 3300006178 Ga0075367_10021796 Ga0075367_100217962 304
121 3300006178 Ga0075367_10023592 Ga0075367_100235925 304
122 3300006871 Ga0075434_100019642 Ga0075434_1000196421 304
123 3300021388 Ga0213875_10001057 Ga0213875_1000105711 304
124 3300025921 Ga0207652_10000474 Ga0207652_1000047442 304
125 3300027866 Ga0209813_10003338 Ga0209813_100033382 304
126 3300028800 Ga0265338_10002416 Ga0265338_1000241620 304
127 3300028800 Ga0265338_10034414 Ga0265338_100344144 304
128 3300031247 Ga0265340_10029359 Ga0265340_100293593 304
129 3300037853 Ga0436364_0461180 Ga0436364_0461180_3231_4184 304
130 3300048908 Ga0496105_0021868 Ga0496105_0021868_1714_2703 304
131 3300049569 Ga0501032_0000320 Ga0501032_0000320_31444_32364 304
132 3300049570 Ga0501033_0002095 Ga0501033_0002095_2540_3460 304
133 3300049571 Ga0501034_0000250 Ga0501034_0000250_13860_14780 304
134 3300049572 Ga0501036_0000956 Ga0501036_0000956_6982_7902 304
135 3300049573 Ga0501037_0000092 Ga0501037_0000092_80857_81777 304
136 3300049574 Ga0501038_0000059 Ga0501038_0000059_51893_52813 304
137 3300049575 Ga0501039_0000547 Ga0501039_0000547_12407_13327 304
138 3300049579 Ga0501043_0001821 Ga0501043_0001821_13810_14730 304
139 3300049580 Ga0501046_0003991 Ga0501046_0003991_472_1392 304
140 3300049581 Ga0501047_0000022 Ga0501047_0000022_119893_120813 304
141 3300049582 Ga0501048_0000821 Ga0501048_0000821_20526_21446 304
142 3300049583 Ga0501067_0000931 Ga0501067_0000931_13730_14650 304
143 3300049585 Ga0501069_0027457 Ga0501069_0027457_133_1053 304
144 3300049586 Ga0501070_0002047 Ga0501070_0002047_13900_14820 304
145 3300049589 Ga0501073_0004115 Ga0501073_0004115_5352_6272 304
146 3300049590 Ga0501074_0000680 Ga0501074_0000680_13758_14678 304
147 3300049668 Ga0501233_001705 Ga0501233_001705_2514_3485 304
148 3300049741 Ga0501079_0032654 Ga0501079_0032654_2196_3116 304
149 3300049742 Ga0501080_0009761 Ga0501080_0009761_1491_2411 304
150 3300049822 Ga0501035_0000240 Ga0501035_0000240_25525_26445 304
151 3300049823 Ga0501044_0000072 Ga0501044_0000072_6490_7410 304
152 3300050494 nmdc:mga06z11_3745_c1 nmdc:mga06z11_3745_c1_1758_2738 304
153 3300050494 nmdc:mga06z11_822_c1 nmdc:mga06z11_822_c1_2603_3598 304
154 3300060353 Ga0501082_0121074 Ga0501082_0121074_1078_1998 304
155 3300005471 Ga0070698_100004357 Ga0070698_1000043576 305
156 3300005618 Ga0068864_100002427 Ga0068864_1000024275 305
157 3300006871 Ga0075434_100623063 Ga0075434_1006230631 305
158 3300009553 Ga0105249_10001922 Ga0105249_1000192215 305
159 3300025915 Ga0207693_10255667 Ga0207693_102556672 305
160 3300025961 Ga0207712_10000642 Ga0207712_100006425 305
161 3300025986 Ga0207658_10001514 Ga0207658_1000151414 305
162 3300026142 Ga0207698_10005222 Ga0207698_1000522210 305
163 3300028794 Ga0307515_10105669 Ga0307515_101056692 305
164 3300037312 Ga0395899_0012696 Ga0395899_0012696_134_1051 305
165 3300037418 Ga0395900_0164496 Ga0395900_0164496_1186_2103 305
166 3300037466 Ga0395898_0120959 Ga0395898_0120959_1294_2211 305
167 3300038443 Ga0395901_0397379 Ga0395901_0397379_278_1195 305
168 3300049823 Ga0501044_0283081 Ga0501044_0283081_470_1414 305
169 3300050512 nmdc:mga0n895_137572_c1 nmdc:mga0n895_137572_c1_1403_2353 305
170 3300005327 Ga0070658_10410081 Ga0070658_104100811 306
171 3300028380 Ga0268265_10350793 Ga0268265_103507931 306
172 3300047320 Ga0495672_0005192 Ga0495672_0005192_7461_8423 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12760

Zn_Tnp_IS1595

Transposase zinc-ribbon domain

6

67

0.97

PF12762

DDE_Tnp_IS1595

ISXO2-like transposase domain

136

278

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qww-assembly3.cif.gz_E crystal structure of multiple antibiotic-resistance repressor (marr) (yp_013417.1) from listeria monocytogenes 4b f2365 at 2.07 a resolution 0.7965 80 123
4lll-assembly4.cif.gz_M crystal structure of s. aureus mepr-dna complex 0.7659 80 118
1ylf-assembly1.cif.gz_B x-ray crystal structure of bc1842 protein from bacillus cereus, a member of the rrf2 family of putative transcription regulators. 0.7648 80 121
5hsm-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis marr family protein rv2887 0.7558 80 126
6fal-assembly1.cif.gz_A tryptophan repressor trpr from e.coli with 3-indolepropionic acid as ligand 0.7495 78 119
ID Description Score Start End Superfamily
3k2zB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8713 80 115 1.10.10.10
1mkmA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.843 78 120 1.10.10.10
2ve8A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8377 80 121 1.10.10.10
2cfxG01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8299 80 118 1.10.10.10
af_P37671_22_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8117 78 114 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A537PSR9-F1-model_v4 Transposase 0.9705 6 122
AF-A0A502Z2A7-F1-model_v4 IS1595 family transposase 0.9672 4 306
AF-A0A258GJ27-F1-model_v4 IS1595 family transposase 0.9648 4 301
AF-A0A512N7J6-F1-model_v4 Transposase zinc-ribbon domain-containing protein 0.9646 11 114
AF-A0A4Q1UNP5-F1-model_v4 IS1595 family transposase 0.9618 4 301

Feature Viewer

pLDDT pTM Quality
90.17 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map