F261209

General Info

Members Datasets Scaffolds Average Seq Length
172 128 344 505

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0029725|Ga0466969_0029725_924_2636
Length 570
Sequence MARRRAERTKKRTDGNRRQVQHPVIPLLKRHEVQVLRRAGLSRPQVEELTGVPRRSVQRIEEEASIGGAAARGRRAGGRMRLDGRXRRGQREPMHSRLLRHEVQVLRRAGLDRAKVQALTGVPVRSIRRIDEEEPITSLDPRDTSKVRPGRPSKSEPYRAFIETVLKDEPELMSLEILRRAKLKGYAGSKTALYDLIASLRPPKQAPVVRFEGLPGEFSQHDFGHVDVRFVDGRIKRVHFFASRLKYSRWAEVTLVEDEGVESLVRSLVAHFDAMGGVPLLAVFDRPKTVVLKWNKDGDVVEYNPTFAAVMLDLGVGIELCWPRSGWQKGSVERIVGWVKSSFFKQRRFVDEDDLRQQLAAWHEEINTRVPSRATGVTPAVRLAEERARMRPLQLKPNDLALRIPIVVGVTGMVVYHTHLYSMAPESIGLSGTLYLYKDKVRIIAGRFSAEHERLFVPHAKSVLPQHRAEMVAAVSGKRAKRYYKREQLLGLGAIALEYLTELVHRKPRTWAGDVDDLYELLTTYGDGPLLRAMELALGETTFGAEYVAHFLHQSLMSVARIGSQERVSS

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
30 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
41 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
44 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
50 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
51 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
52 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
53 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
54 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
55 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
56 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
57 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
58 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
63 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
64 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
65 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
66 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
67 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
71 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
72 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
83 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
84 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
85 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
86 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
87 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
88 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
89 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
92 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
93 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
94 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
95 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
108 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
109 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
110 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
111 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
112 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
116 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
123 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
124 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
125 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
126 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
127 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.09
Stem 0
Stem Tuber 0
Unclassified 15.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0029725 3300044656 Bacteria 2788
2 rootL2_10117880 3300003322 Bacteria 2516
3 rootH1_10214103 3300003323 Unclassified 1873
4 Ga0070670_100112785 3300005331 Unclassified 2344
5 Ga0070674_100096146 3300005356 Bacteria 2149
6 Ga0070705_100034747 3300005440 Bacteria 2821
7 Ga0070708_100065815 3300005445 Bacteria 3251
8 Ga0070681_10036169 3300005458 Unclassified 4960
9 Ga0070681_10106373 3300005458 Bacteria 2747
10 Ga0070681_10233483 3300005458 Unclassified 1754
11 Ga0070706_100045831 3300005467 Unclassified 4037
12 Ga0070706_100075590 3300005467 Bacteria 3117
13 Ga0070706_100108935 3300005467 Unclassified 2577
14 Ga0070707_100093343 3300005468 Bacteria 2913
15 Ga0070698_100063728 3300005471 Bacteria 3717
16 Ga0070698_100096479 3300005471 Bacteria 2933
17 Ga0070698_100107909 3300005471 Bacteria 2752
18 Ga0070698_100197973 3300005471 Bacteria 1945
19 Ga0070699_100067981 3300005518 Bacteria 3093
20 Ga0070699_100104965 3300005518 Unclassified 2478
21 Ga0070679_100063306 3300005530 Bacteria 3687
22 Ga0070679_100110361 3300005530 Unclassified 2737
23 Ga0070697_100067640 3300005536 Bacteria 2923
24 Ga0070697_100082572 3300005536 Bacteria 2649
25 Ga0070686_100063741 3300005544 Archaea 2388
26 Ga0070704_100016642 3300005549 Unclassified 4652
27 Ga0068856_100110361 3300005614 Bacteria 2748
28 Ga0081538_10045098 3300005981 Bacteria 2738
29 Ga0081539_10002848 3300005985 Bacteria 23016
30 Ga0070717_10159797 3300006028 Bacteria 1954
31 Ga0075428_100141311 3300006844 Bacteria 2618
32 Ga0075434_100081798 3300006871 Unclassified 3226
33 Ga0075434_100118735 3300006871 Bacteria 2659
34 Ga0075434_100137473 3300006871 Bacteria 2463
35 Ga0075435_100051101 3300007076 Bacteria 3329
36 Ga0075435_100071762 3300007076 Bacteria 2828
37 Ga0105247_10012941 3300009101 Bacteria 5003
38 Ga0114129_10155360 3300009147 Bacteria 3129
39 Ga0114129_10165553 3300009147 Unclassified 3018
40 Ga0114129_10198291 3300009147 Bacteria 2721
41 Ga0105238_10229478 3300009551 Bacteria 1833
42 Ga0157369_10115197 3300013105 Bacteria 2855
43 Ga0157372_10125530 3300013307 Bacteria 2950
44 Ga0157372_10155960 3300013307 Unclassified 2637
45 Ga0213876_10058424 3300021384 Bacteria 2036
46 Ga0213876_10062366 3300021384 Bacteria 1967
47 Ga0207710_10004878 3300025900 Bacteria 5818
48 Ga0207688_10038593 3300025901 Bacteria 2651
49 Ga0207684_10090222 3300025910 Unclassified 2611
50 Ga0207707_10019448 3300025912 Bacteria 5928
51 Ga0207707_10098421 3300025912 Unclassified 2557
52 Ga0207707_10108419 3300025912 Bacteria 2428
53 Ga0207707_10218251 3300025912 Unclassified 1660
54 Ga0207660_10039253 3300025917 Bacteria 3309
55 Ga0207652_10001243 3300025921 Bacteria 22729
56 Ga0207694_10090170 3300025924 Bacteria 2418
57 Ga0207664_10100384 3300025929 Unclassified 2390
58 Ga0207711_10141837 3300025941 Bacteria 2163
59 Ga0209971_1004659 3300027682 Bacteria 3253
60 Ga0209974_10016208 3300027876 Bacteria 2475
61 Ga0307511_10062837 3300030521 Unclassified 2812
62 Ga0307408_100068437 3300031548 Bacteria 2614
63 Ga0307405_10038941 3300031731 Bacteria 2869
64 Ga0307413_10048427 3300031824 Bacteria 2540
65 Ga0307410_10011755 3300031852 Bacteria 5025
66 Ga0307406_10053617 3300031901 Bacteria 2569
67 Ga0307409_100077280 3300031995 Bacteria 2673
68 Ga0307416_100022456 3300032002 Bacteria 4555
69 Ga0307411_10021806 3300032005 Bacteria 3757
70 Ga0373934_0003260 3300035086 Bacteria 5933
71 Ga0373923_0013570 3300035111 Bacteria 3039
72 Ga0373923_0020385 3300035111 Bacteria 2575
73 Ga0373953_0019786 3300035117 Bacteria 2508
74 Ga0373954_0028808 3300035118 Bacteria 2554
75 Ga0373956_0012053 3300035119 Bacteria 3575
76 Ga0373957_0010217 3300035120 Bacteria 3095
77 Ga0373955_0033258 3300035172 Bacteria 2714
78 Ga0373924_0007046 3300035410 Unclassified 4048
79 Ga0373924_0019574 3300035410 Bacteria 2623
80 Ga0373935_0043584 3300035692 Bacteria 2824
81 Ga0373933_0028577 3300035724 Bacteria 3218
82 Ga0373937_0015874 3300036401 Bacteria 6677
83 Ga0373937_0107757 3300036401 Bacteria 2590
84 Ga0373937_0113835 3300036401 Bacteria 2517
85 Ga0373937_0122826 3300036401 Bacteria 2421
86 Ga0395901_0114596 3300038443 Bacteria 2831
87 Ga0439448_0006382 3300042005 Bacteria 3390
88 Ga0439464_0021782 3300042439 Bacteria 1760
89 Ga0439460_0009009 3300042461 Bacteria 2525
90 Ga0466972_0026603 3300044658 Bacteria 2867
91 Ga0453683_0009502 3300044673 Bacteria 6490
92 Ga0453683_0022656 3300044673 Bacteria 4005
93 Ga0466965_0032509 3300044683 Bacteria 2548
94 Ga0466966_0041933 3300044684 Bacteria 2940
95 Ga0466966_0093211 3300044684 Unclassified 1868
96 Ga0466961_0050569 3300044693 Bacteria 2654
97 Ga0466964_0009070 3300044706 Bacteria 3741
98 Ga0466968_0018516 3300044735 Bacteria 2793
99 Ga0466970_0021265 3300044765 Bacteria 3378
100 Ga0466970_0063270 3300044765 Bacteria 1984
101 Ga0466959_0068502 3300045049 Bacteria 2571
102 Ga0451576_0052122 3300045051 Bacteria 4288
103 Ga0451576_0064828 3300045051 Bacteria 3805
104 Ga0451576_0066655 3300045051 Bacteria 3747
105 Ga0451576_0352556 3300045051 Unclassified 1541
106 Ga0466958_0031333 3300045836 Bacteria 3160
107 Ga0495592_0028823 3300046454 Bacteria 4201
108 Ga0495592_0056287 3300046454 Bacteria 2907
109 Ga0495651_0061636 3300046462 Bacteria 2870
110 Ga0495608_0010979 3300046511 Bacteria 6313
111 Ga0495608_0024936 3300046511 Bacteria 4086
112 Ga0495618_0138561 3300046514 Bacteria 1556
113 Ga0495644_0025478 3300046523 Unclassified 2245
114 Ga0495652_0063728 3300046529 Bacteria 3102
115 Ga0495667_0014934 3300046559 Bacteria 5247
116 Ga0495667_0053989 3300046559 Bacteria 2645
117 Ga0495656_0020030 3300046615 Unclassified 2590
118 Ga0495635_0041281 3300046663 Bacteria 3187
119 Ga0495657_0056840 3300046675 Bacteria 2603
120 Ga0495623_0049641 3300046679 Bacteria 2659
121 Ga0495646_0053066 3300046680 Bacteria 2446
122 Ga0495600_0057101 3300046809 Bacteria 2550
123 Ga0495674_0053578 3300047319 Unclassified 3545
124 Ga0495674_0072148 3300047319 Bacteria 2978
125 Ga0495680_0053265 3300047322 Bacteria 3150
126 Ga0495675_0050758 3300047444 Bacteria 2636
127 Ga0495684_0013310 3300047471 Bacteria 6339
128 Ga0495602_0076262 3300048088 Bacteria 2841
129 Ga0501298_002765 3300049521 Bacteria 2681
130 Ga0501299_001566 3300049522 Bacteria 2980
131 Ga0501032_0076113 3300049569 Bacteria 2235
132 Ga0501036_0076750 3300049572 Bacteria 2827
133 Ga0501037_0136353 3300049573 Bacteria 1758
134 Ga0501040_0060741 3300049576 Bacteria 2598
135 Ga0501041_0045127 3300049577 Bacteria 2679
136 Ga0501043_0182612 3300049579 Bacteria 1634
137 Ga0501047_0063731 3300049581 Bacteria 3555
138 Ga0501072_0069763 3300049588 Bacteria 2775
139 Ga0501074_0083301 3300049590 Unclassified 2293
140 Ga0501075_0082012 3300049591 Bacteria 2442
141 Ga0501075_0084423 3300049591 Bacteria 2405
142 Ga0501075_0096578 3300049591 Unclassified 2243
143 Ga0501076_0130036 3300049592 Bacteria 2042
144 Ga0501077_0066060 3300049593 Bacteria 2294
145 Ga0501077_0069859 3300049593 Bacteria 2226
146 Ga0501201_000867 3300049651 Bacteria 2835
147 Ga0501202_003286 3300049652 Bacteria 2762
148 Ga0501208_000828 3300049655 Bacteria 2638
149 Ga0501217_005822 3300049661 Bacteria 2592
150 Ga0501233_006713 3300049668 Bacteria 2170
151 Ga0501079_0044858 3300049741 Bacteria 3412
152 Ga0501079_0098682 3300049741 Bacteria 2264
153 Ga0501080_0137748 3300049742 Bacteria 2258
154 Ga0501081_0010546 3300049743 Bacteria 6032
155 Ga0501083_0038296 3300049744 Bacteria 3260
156 Ga0501035_0065377 3300049822 Unclassified 3230
157 nmdc:mga05p37_1400_c1 3300050507 Bacteria 28057
158 nmdc:mga05p37_88887_c1 3300050507 Bacteria 3808
159 nmdc:mga09592_1104_c1 3300050508 Bacteria 21453
160 nmdc:mga09592_133039_c1 3300050508 Bacteria 2141
161 nmdc:mga08y16_95184_c1 3300050511 Bacteria 3102
162 nmdc:mga0n895_127512_c1 3300050512 Bacteria 2569
163 nmdc:mga0n895_172927_c1 3300050512 Bacteria 2192
164 nmdc:mga0n895_84880_c1 3300050512 Bacteria 3160
165 nmdc:mga0rr50_77767_c1 3300050513 Bacteria 2551
166 nmdc:mga08x19_4152_c1 3300050514 Bacteria 8589
167 nmdc:mga0a205_51423_c1 3300050515 Bacteria 3978
168 Ga0495601_0017319 3300053077 Bacteria 4371
169 Ga0495595_0015873 3300053084 Bacteria 3216
170 Ga0495619_0015534 3300053085 Plasmid 4817
171 Ga0501082_0058194 3300060353 Bacteria 3330
172 Ga0501082_0086998 3300060353 Bacteria 2696
173 Ga0466969_0029725
174 rootL2_10117880
175 rootH1_10214103
176 Ga0070670_100112785
177 Ga0070674_100096146
178 Ga0070705_100034747
179 Ga0070708_100065815
180 Ga0070681_10036169
181 Ga0070681_10106373
182 Ga0070681_10233483
183 Ga0070706_100045831
184 Ga0070706_100075590
185 Ga0070706_100108935
186 Ga0070707_100093343
187 Ga0070698_100063728
188 Ga0070698_100096479
189 Ga0070698_100107909
190 Ga0070698_100197973
191 Ga0070699_100067981
192 Ga0070699_100104965
193 Ga0070679_100063306
194 Ga0070679_100110361
195 Ga0070697_100067640
196 Ga0070697_100082572
197 Ga0070686_100063741
198 Ga0070704_100016642
199 Ga0068856_100110361
200 Ga0081538_10045098
201 Ga0081539_10002848
202 Ga0070717_10159797
203 Ga0075428_100141311
204 Ga0075434_100081798
205 Ga0075434_100118735
206 Ga0075434_100137473
207 Ga0075435_100051101
208 Ga0075435_100071762
209 Ga0105247_10012941
210 Ga0114129_10155360
211 Ga0114129_10165553
212 Ga0114129_10198291
213 Ga0105238_10229478
214 Ga0157369_10115197
215 Ga0157372_10125530
216 Ga0157372_10155960
217 Ga0213876_10058424
218 Ga0213876_10062366
219 Ga0207710_10004878
220 Ga0207688_10038593
221 Ga0207684_10090222
222 Ga0207707_10019448
223 Ga0207707_10098421
224 Ga0207707_10108419
225 Ga0207707_10218251
226 Ga0207660_10039253
227 Ga0207652_10001243
228 Ga0207694_10090170
229 Ga0207664_10100384
230 Ga0207711_10141837
231 Ga0209971_1004659
232 Ga0209974_10016208
233 Ga0307511_10062837
234 Ga0307408_100068437
235 Ga0307405_10038941
236 Ga0307413_10048427
237 Ga0307410_10011755
238 Ga0307406_10053617
239 Ga0307409_100077280
240 Ga0307416_100022456
241 Ga0307411_10021806
242 Ga0373934_0003260
243 Ga0373923_0013570
244 Ga0373923_0020385
245 Ga0373953_0019786
246 Ga0373954_0028808
247 Ga0373956_0012053
248 Ga0373957_0010217
249 Ga0373955_0033258
250 Ga0373924_0007046
251 Ga0373924_0019574
252 Ga0373935_0043584
253 Ga0373933_0028577
254 Ga0373937_0015874
255 Ga0373937_0107757
256 Ga0373937_0113835
257 Ga0373937_0122826
258 Ga0395901_0114596
259 Ga0439448_0006382
260 Ga0439464_0021782
261 Ga0439460_0009009
262 Ga0466972_0026603
263 Ga0453683_0009502
264 Ga0453683_0022656
265 Ga0466965_0032509
266 Ga0466966_0041933
267 Ga0466966_0093211
268 Ga0466961_0050569
269 Ga0466964_0009070
270 Ga0466968_0018516
271 Ga0466970_0021265
272 Ga0466970_0063270
273 Ga0466959_0068502
274 Ga0451576_0052122
275 Ga0451576_0064828
276 Ga0451576_0066655
277 Ga0451576_0352556
278 Ga0466958_0031333
279 Ga0495592_0028823
280 Ga0495592_0056287
281 Ga0495651_0061636
282 Ga0495608_0010979
283 Ga0495608_0024936
284 Ga0495618_0138561
285 Ga0495644_0025478
286 Ga0495652_0063728
287 Ga0495667_0014934
288 Ga0495667_0053989
289 Ga0495656_0020030
290 Ga0495635_0041281
291 Ga0495657_0056840
292 Ga0495623_0049641
293 Ga0495646_0053066
294 Ga0495600_0057101
295 Ga0495674_0053578
296 Ga0495674_0072148
297 Ga0495680_0053265
298 Ga0495675_0050758
299 Ga0495684_0013310
300 Ga0495602_0076262
301 Ga0501298_002765
302 Ga0501299_001566
303 Ga0501032_0076113
304 Ga0501036_0076750
305 Ga0501037_0136353
306 Ga0501040_0060741
307 Ga0501041_0045127
308 Ga0501043_0182612
309 Ga0501047_0063731
310 Ga0501072_0069763
311 Ga0501074_0083301
312 Ga0501075_0082012
313 Ga0501075_0084423
314 Ga0501075_0096578
315 Ga0501076_0130036
316 Ga0501077_0066060
317 Ga0501077_0069859
318 Ga0501201_000867
319 Ga0501202_003286
320 Ga0501208_000828
321 Ga0501217_005822
322 Ga0501233_006713
323 Ga0501079_0044858
324 Ga0501079_0098682
325 Ga0501080_0137748
326 Ga0501081_0010546
327 Ga0501083_0038296
328 Ga0501035_0065377
329 nmdc:mga05p37_1400_c1
330 nmdc:mga05p37_88887_c1
331 nmdc:mga09592_1104_c1
332 nmdc:mga09592_133039_c1
333 nmdc:mga08y16_95184_c1
334 nmdc:mga0n895_127512_c1
335 nmdc:mga0n895_172927_c1
336 nmdc:mga0n895_84880_c1
337 nmdc:mga0rr50_77767_c1
338 nmdc:mga08x19_4152_c1
339 nmdc:mga0a205_51423_c1
340 Ga0495601_0017319
341 Ga0495595_0015873
342 Ga0495619_0015534
343 Ga0501082_0058194
344 Ga0501082_0086998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x48-assembly1.cif.gz_A orf 55 from sulfolobus islandicus rudivirus 1 0.9791 6 40
2r0q-assembly1.cif.gz_F crystal structure of a serine recombinase- dna regulatory complex 0.9062 5 41
6qbv-assembly2.cif.gz_D structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form) 0.8419 121 291
6qbv-assembly1.cif.gz_B structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form) 0.8401 122 291
6qbv-assembly2.cif.gz_D structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form) 0.8154 121 291
ID Description Score Start End Superfamily
af_P23758_5_73_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9762 1 37 1.10.10.10
af_P24610_34_102_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9719 1 36 1.10.10.10
2x48C00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9549 6 40 1.10.10.60
2r0qF02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9062 5 41 1.10.10.60
af_O53646_7_211_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8644 4 37 3.40.50.2300
ID Description Score Start End GO Terms
AF-A9FV56-F1-model_v4 Transposase 0.9349 136 273 GO:0003676
GO:0015074
AF-A0A2V8UYV9-F1-model_v4 Uncharacterized protein 0.9142 331 471
AF-A0A2V6XBC8-F1-model_v4 Integrase catalytic domain-containing protein 0.9087 134 468 GO:0003676
GO:0015074
AF-A0A2V6XBC8-F1-model_v4 Integrase catalytic domain-containing protein 0.8985 134 468 GO:0003676
GO:0015074
AF-A0A2V8UYV9-F1-model_v4 Uncharacterized protein 0.8961 331 471

Map