F260284

General Info

Members Datasets Scaffolds Average Seq Length
172 126 344 271

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100468718|Ga0070678_1004687181
Length 306
Sequence VIDQLIQRGRAPLFVIAGPCVIESYELCLEVGRHVKRVCEGLGLAYVFKASFDKANRSSNSSFRGPGVEGGLKILERLKGELGVPVLTDVHESEQVPTVARVVDILQVPAFLARQTDLLVACGHSGKTVNIKKGQFMSPQEMGNAVEKVRGARAEGSGFRVQGSEGTNPAASSLNAEPRTLNPPVNPPVMLTERGTFFGYNRLVNDFTGLPVMKSFGCPVVFDVTHSTQQPAGLGNQSGGNPQYSPMLARAAVAAGVDGLFLECHPEPKKAKSDAATMLGLEAVEPLLTQCKQIADLRQRWDTNRV

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
80 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
81 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
107 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.58
Rhizosphere 98.26
Stem 0
Stem Tuber 0
Unclassified 5.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100468718 3300005456 Bacteria 1106
2 Ga0070658_10003105 3300005327 Bacteria 13702
3 Ga0070658_10018976 3300005327 Bacteria 5510
4 Ga0070683_100215316 3300005329 Bacteria 1825
5 Ga0070670_100031276 3300005331 Bacteria 4583
6 Ga0070666_10412279 3300005335 Bacteria 972
7 Ga0070660_100203739 3300005339 Bacteria 1605
8 Ga0070687_100080063 3300005343 Bacteria 1780
9 Ga0070675_100195987 3300005354 Bacteria 1752
10 Ga0070673_100024577 3300005364 Bacteria 4421
11 Ga0070688_100080748 3300005365 Bacteria 2104
12 Ga0070667_100015092 3300005367 Bacteria 6381
13 Ga0070714_100009270 3300005435 Bacteria 7735
14 Ga0070713_100478068 3300005436 Bacteria 1173
15 Ga0070705_100106356 3300005440 Bacteria 1783
16 Ga0070708_100091832 3300005445 Bacteria 2765
17 Ga0070708_100206839 3300005445 Bacteria 1839
18 Ga0070708_100491324 3300005445 Bacteria 1158
19 Ga0070706_100000395 3300005467 Bacteria 52527
20 Ga0070706_100013857 3300005467 Bacteria 7455
21 Ga0070706_100106824 3300005467 Bacteria 2604
22 Ga0070707_100000528 3300005468 Bacteria 38173
23 Ga0070707_100002691 3300005468 Bacteria 16893
24 Ga0070698_100074322 3300005471 Bacteria 3404
25 Ga0070699_100137561 3300005518 Bacteria 2155
26 Ga0070699_100202956 3300005518 Bacteria 1763
27 Ga0070697_100003066 3300005536 Bacteria 12812
28 Ga0070697_100042402 3300005536 Bacteria 3683
29 Ga0070697_100117973 3300005536 Bacteria 2217
30 Ga0070672_100074345 3300005543 Bacteria 2711
31 Ga0070696_100067123 3300005546 Bacteria 2517
32 Ga0070665_100000142 3300005548 Bacteria 133773
33 Ga0068855_100919572 3300005563 Bacteria 923
34 Ga0070664_100159987 3300005564 Bacteria 1992
35 Ga0068856_100181607 3300005614 Bacteria 2117
36 Ga0068859_100004682 3300005617 Bacteria 13927
37 Ga0068859_100389862 3300005617 Bacteria 1488
38 Ga0068864_100113040 3300005618 Bacteria 2421
39 Ga0068864_100278237 3300005618 Bacteria 1561
40 Ga0068864_100474646 3300005618 Bacteria 1200
41 Ga0068861_100391523 3300005719 Bacteria 1231
42 Ga0068863_100177573 3300005841 Bacteria 2044
43 Ga0068860_100088311 3300005843 Bacteria 2951
44 Ga0075430_100026615 3300006846 Bacteria 4918
45 Ga0075431_100395591 3300006847 Bacteria 1384
46 Ga0075433_10014850 3300006852 Bacteria 6374
47 Ga0097620_100389873 3300006931 Bacteria 1488
48 Ga0105240_10013909 3300009093 Bacteria 11016
49 Ga0111539_10202094 3300009094 Bacteria 2317
50 Ga0105245_10072103 3300009098 Bacteria 3137
51 Ga0105245_10479987 3300009098 Bacteria 1256
52 Ga0114129_11306212 3300009147 Bacteria 899
53 Ga0105243_10279817 3300009148 Bacteria 1502
54 Ga0105241_10290299 3300009174 Bacteria 1400
55 Ga0105241_10384873 3300009174 Unclassified 1226
56 Ga0105242_10433057 3300009176 Bacteria 1235
57 Ga0105237_10000037 3300009545 Bacteria 190855
58 Ga0105237_10539307 3300009545 Bacteria 1173
59 Ga0105238_10935801 3300009551 Bacteria 886
60 Ga0105249_10691318 3300009553 Bacteria 1080
61 Ga0105239_10111628 3300010375 Bacteria 3031
62 Ga0105239_10443368 3300010375 Bacteria 1472
63 Ga0157370_10037219 3300013104 Bacteria 4717
64 Ga0157369_10492084 3300013105 Bacteria 1269
65 Ga0157372_10055138 3300013307 Bacteria 4437
66 Ga0157372_10083506 3300013307 Bacteria 3618
67 Ga0157372_10091637 3300013307 Bacteria 3457
68 Ga0157372_10143250 3300013307 Bacteria 2756
69 Ga0157372_10718835 3300013307 Bacteria 1162
70 Ga0163163_10056434 3300014325 Bacteria 3882
71 Ga0157379_10462323 3300014968 Unclassified 1173
72 Ga0157376_10163360 3300014969 Bacteria 2021
73 Ga0213875_10007773 3300021388 Bacteria 5510
74 Ga0207705_10001761 3300025909 Bacteria 17095
75 Ga0207684_10000670 3300025910 Bacteria 40606
76 Ga0207684_10001495 3300025910 Bacteria 25125
77 Ga0207684_10081013 3300025910 Bacteria 2762
78 Ga0207695_10000112 3300025913 Bacteria 248037
79 Ga0207695_10055544 3300025913 Bacteria 4126
80 Ga0207657_10143873 3300025919 Bacteria 1946
81 Ga0207646_10007761 3300025922 Bacteria 10859
82 Ga0207694_10049814 3300025924 Bacteria 3242
83 Ga0207650_10057295 3300025925 Bacteria 2898
84 Ga0207687_10110415 3300025927 Bacteria 2039
85 Ga0207664_10025117 3300025929 Bacteria 4483
86 Ga0207664_10124453 3300025929 Bacteria 2163
87 Ga0207686_10261576 3300025934 Bacteria 1269
88 Ga0207709_10149805 3300025935 Bacteria 1614
89 Ga0207691_10063257 3300025940 Bacteria 3356
90 Ga0207661_10761637 3300025944 Bacteria 891
91 Ga0207679_10019545 3300025945 Bacteria 4553
92 Ga0207667_10029486 3300025949 Bacteria 5950
93 Ga0207667_10408410 3300025949 Bacteria 1382
94 Ga0207651_10080107 3300025960 Bacteria 2349
95 Ga0207658_10155118 3300025986 Bacteria 1870
96 Ga0207703_10045190 3300026035 Bacteria 3542
97 Ga0207703_10445847 3300026035 Bacteria 1208
98 Ga0207702_10135071 3300026078 Bacteria 2224
99 Ga0207702_10296363 3300026078 Bacteria 1533
100 Ga0207641_10302360 3300026088 Bacteria 1512
101 Ga0207641_10460920 3300026088 Bacteria 1230
102 Ga0207674_10000506 3300026116 Bacteria 51206
103 Ga0207674_10197717 3300026116 Bacteria 1960
104 Ga0207675_100111553 3300026118 Bacteria 2580
105 Ga0207698_10718092 3300026142 Bacteria 996
106 Ga0207428_10372361 3300027907 Bacteria 1049
107 Ga0268266_10000081 3300028379 Bacteria 207431
108 Ga0265337_1003430 3300028556 Bacteria 6874
109 Ga0265336_10014820 3300028666 Bacteria 2576
110 Ga0265760_10000045 3300031090 Bacteria 37398
111 Ga0307405_10404847 3300031731 Bacteria 1069
112 Ga0307407_10294153 3300031903 Bacteria 1130
113 Ga0307409_100002235 3300031995 Bacteria 10001
114 Ga0307414_10531618 3300032004 Bacteria 1045
115 Ga0373935_0004028 3300035692 Bacteria 8589
116 Ga0373927_0008167 3300035695 Bacteria 7057
117 Ga0373933_0177891 3300035724 Bacteria 1356
118 Ga0373947_0101368 3300035725 Bacteria 1810
119 Ga0316582_0066579 3300036647 Bacteria 2323
120 Ga0373925_0079640 3300037068 Bacteria 2489
121 Ga0373925_0298766 3300037068 Bacteria 1300
122 Ga0395898_0002469 3300037466 Bacteria 21810
123 Ga0395905_0152605 3300037471 Bacteria 2173
124 Ga0436364_0867562 3300037853 Bacteria 11000
125 Ga0451577_0189524 3300042876 Bacteria 1855
126 Ga0451577_0340286 3300042876 Bacteria 1361
127 Ga0453684_0034546 3300044712 Bacteria 7015
128 Ga0453684_0174541 3300044712 Bacteria 2530
129 Ga0453684_0266281 3300044712 Bacteria 1961
130 Ga0453684_0321949 3300044712 Bacteria 1751
131 Ga0451576_0000143 3300045051 Bacteria 180834
132 Ga0451576_1164764 3300045051 Bacteria 806
133 Ga0495641_0103150 3300046461 Unclassified 1272
134 Ga0495580_0048577 3300046472 Bacteria 3004
135 Ga0495580_0460903 3300046472 Unclassified 852
136 Ga0495582_0006650 3300046473 Bacteria 6423
137 Ga0495662_0184511 3300046476 Bacteria 1028
138 Ga0495618_0010779 3300046514 Bacteria 5536
139 Ga0495630_0012950 3300046517 Bacteria 6058
140 Ga0495630_0058408 3300046517 Bacteria 2892
141 Ga0495630_0071723 3300046517 Bacteria 2607
142 Ga0495665_0045478 3300046531 Bacteria 2332
143 Ga0495640_0020438 3300046533 Bacteria 4872
144 Ga0495667_0118840 3300046559 Unclassified 1707
145 Ga0495647_0146551 3300046681 Bacteria 1010
146 Ga0495658_0003470 3300046683 Bacteria 7793
147 Ga0495613_0009996 3300046689 Bacteria 7048
148 Ga0495613_0100987 3300046689 Unclassified 2083
149 Ga0495613_0102469 3300046689 Bacteria 2067
150 Ga0495613_0476911 3300046689 Bacteria 842
151 Ga0495624_0015248 3300046690 Bacteria 5197
152 Ga0495624_0038088 3300046690 Unclassified 3091
153 Ga0495674_0008323 3300047319 Bacteria 9889
154 Ga0495676_0045060 3300047321 Unclassified 3594
155 Ga0495676_0567968 3300047321 Bacteria 740
156 Ga0495686_0094555 3300047472 Bacteria 1811
157 Ga0496115_0093242 3300048918 Bacteria 2462
158 Ga0501032_0035455 3300049569 Bacteria 3410
159 Ga0501034_0092293 3300049571 Bacteria 3025
160 Ga0501037_0111612 3300049573 Bacteria 1969
161 Ga0501047_0081509 3300049581 Bacteria 3110
162 Ga0501047_0147159 3300049581 Bacteria 2232
163 Ga0501047_0360702 3300049581 Unclassified 1289
164 Ga0501073_0002487 3300049589 Bacteria 13756
165 Ga0501083_0159998 3300049744 Unclassified 1473
166 Ga0501044_0006825 3300049823 Bacteria 12577
167 nmdc:mga06r32_60573_c1 3300050510 Bacteria 3643
168 nmdc:mga08y16_541472_c1 3300050511 Bacteria 1179
169 nmdc:mga08y16_700485_c1 3300050511 Bacteria 1013
170 Ga0501084_0319037 3300054114 Bacteria 1312
171 Ga0590075_030719 3300059424 Bacteria 1360
172 Ga0501082_0412294 3300060353 Bacteria 1179
173 Ga0070678_100468718
174 Ga0070658_10003105
175 Ga0070658_10018976
176 Ga0070683_100215316
177 Ga0070670_100031276
178 Ga0070666_10412279
179 Ga0070660_100203739
180 Ga0070687_100080063
181 Ga0070675_100195987
182 Ga0070673_100024577
183 Ga0070688_100080748
184 Ga0070667_100015092
185 Ga0070714_100009270
186 Ga0070713_100478068
187 Ga0070705_100106356
188 Ga0070708_100091832
189 Ga0070708_100206839
190 Ga0070708_100491324
191 Ga0070706_100000395
192 Ga0070706_100013857
193 Ga0070706_100106824
194 Ga0070707_100000528
195 Ga0070707_100002691
196 Ga0070698_100074322
197 Ga0070699_100137561
198 Ga0070699_100202956
199 Ga0070697_100003066
200 Ga0070697_100042402
201 Ga0070697_100117973
202 Ga0070672_100074345
203 Ga0070696_100067123
204 Ga0070665_100000142
205 Ga0068855_100919572
206 Ga0070664_100159987
207 Ga0068856_100181607
208 Ga0068859_100004682
209 Ga0068859_100389862
210 Ga0068864_100113040
211 Ga0068864_100278237
212 Ga0068864_100474646
213 Ga0068861_100391523
214 Ga0068863_100177573
215 Ga0068860_100088311
216 Ga0075430_100026615
217 Ga0075431_100395591
218 Ga0075433_10014850
219 Ga0097620_100389873
220 Ga0105240_10013909
221 Ga0111539_10202094
222 Ga0105245_10072103
223 Ga0105245_10479987
224 Ga0114129_11306212
225 Ga0105243_10279817
226 Ga0105241_10290299
227 Ga0105241_10384873
228 Ga0105242_10433057
229 Ga0105237_10000037
230 Ga0105237_10539307
231 Ga0105238_10935801
232 Ga0105249_10691318
233 Ga0105239_10111628
234 Ga0105239_10443368
235 Ga0157370_10037219
236 Ga0157369_10492084
237 Ga0157372_10055138
238 Ga0157372_10083506
239 Ga0157372_10091637
240 Ga0157372_10143250
241 Ga0157372_10718835
242 Ga0163163_10056434
243 Ga0157379_10462323
244 Ga0157376_10163360
245 Ga0213875_10007773
246 Ga0207705_10001761
247 Ga0207684_10000670
248 Ga0207684_10001495
249 Ga0207684_10081013
250 Ga0207695_10000112
251 Ga0207695_10055544
252 Ga0207657_10143873
253 Ga0207646_10007761
254 Ga0207694_10049814
255 Ga0207650_10057295
256 Ga0207687_10110415
257 Ga0207664_10025117
258 Ga0207664_10124453
259 Ga0207686_10261576
260 Ga0207709_10149805
261 Ga0207691_10063257
262 Ga0207661_10761637
263 Ga0207679_10019545
264 Ga0207667_10029486
265 Ga0207667_10408410
266 Ga0207651_10080107
267 Ga0207658_10155118
268 Ga0207703_10045190
269 Ga0207703_10445847
270 Ga0207702_10135071
271 Ga0207702_10296363
272 Ga0207641_10302360
273 Ga0207641_10460920
274 Ga0207674_10000506
275 Ga0207674_10197717
276 Ga0207675_100111553
277 Ga0207698_10718092
278 Ga0207428_10372361
279 Ga0268266_10000081
280 Ga0265337_1003430
281 Ga0265336_10014820
282 Ga0265760_10000045
283 Ga0307405_10404847
284 Ga0307407_10294153
285 Ga0307409_100002235
286 Ga0307414_10531618
287 Ga0373935_0004028
288 Ga0373927_0008167
289 Ga0373933_0177891
290 Ga0373947_0101368
291 Ga0316582_0066579
292 Ga0373925_0079640
293 Ga0373925_0298766
294 Ga0395898_0002469
295 Ga0395905_0152605
296 Ga0436364_0867562
297 Ga0451577_0189524
298 Ga0451577_0340286
299 Ga0453684_0034546
300 Ga0453684_0174541
301 Ga0453684_0266281
302 Ga0453684_0321949
303 Ga0451576_0000143
304 Ga0451576_1164764
305 Ga0495641_0103150
306 Ga0495580_0048577
307 Ga0495580_0460903
308 Ga0495582_0006650
309 Ga0495662_0184511
310 Ga0495618_0010779
311 Ga0495630_0012950
312 Ga0495630_0058408
313 Ga0495630_0071723
314 Ga0495665_0045478
315 Ga0495640_0020438
316 Ga0495667_0118840
317 Ga0495647_0146551
318 Ga0495658_0003470
319 Ga0495613_0009996
320 Ga0495613_0100987
321 Ga0495613_0102469
322 Ga0495613_0476911
323 Ga0495624_0015248
324 Ga0495624_0038088
325 Ga0495674_0008323
326 Ga0495676_0045060
327 Ga0495676_0567968
328 Ga0495686_0094555
329 Ga0496115_0093242
330 Ga0501032_0035455
331 Ga0501034_0092293
332 Ga0501037_0111612
333 Ga0501047_0081509
334 Ga0501047_0147159
335 Ga0501047_0360702
336 Ga0501073_0002487
337 Ga0501083_0159998
338 Ga0501044_0006825
339 nmdc:mga06r32_60573_c1
340 nmdc:mga08y16_541472_c1
341 nmdc:mga08y16_700485_c1
342 Ga0501084_0319037
343 Ga0590075_030719
344 Ga0501082_0412294

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00793

DAHP_synth_1

DAHP synthetase I family

2

300

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fs2-assembly1.cif.gz_A crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from bruciella melitensis at 1.85a resolution 0.988 3 272
6bng-assembly1.cif.gz_A-2 structure of 2-dehydro-3-deoxyphosphooctonate aldolase from acinetobacter baumannii 0.9849 3 271
2nxg-assembly1.cif.gz_B structural and mechanistic changes along an engineered path from metallo to non-metallo kdo8p synthase. 0.9838 17 272
1lrq-assembly1.cif.gz_B aquifex aeolicus kdo8p synthase h185g mutant in complex with pep, a5p and cadmium 0.9836 17 272
3fs2-assembly1.cif.gz_B crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from bruciella melitensis at 1.85a resolution 0.9835 3 272
ID Description Score Start End Superfamily
1fwtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9802 15 273 3.20.20.70
1o60D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9664 2 271 3.20.20.70
1fwtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9618 15 273 3.20.20.70
4z1aA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9337 17 269 3.20.20.70
1o60D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.93 2 271 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A382EZY0-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9995 36 146 GO:0005737
GO:0008676
GO:0009058
AF-A0A7X7F580-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9973 19 143 GO:0005737
GO:0008676
GO:0009103
AF-A0A7S3CIV1-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9952 48 166 GO:0005737
GO:0008676
GO:0009058
AF-A0A382NXE0-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9948 17 141 GO:0005737
GO:0008676
GO:0009058
AF-A0A3D5Q0Z1-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9939 16 114 GO:0005737
GO:0008676
GO:0009103

Map