F260026

General Info

Members Datasets Scaffolds Average Seq Length
172 129 344 97

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10522137|Ga0070658_105221372
Length 119
Sequence MFVTPGLTRGPAFRSSQPMDRERKGGWVYMMADRYRGAMYVGVTSDLAARIHQHRNGSGSDFCRRYGLNRLVWADRGDAIEDCIAHEKRLKRWRREWKFALIERANPDWVDLYDHLAGT

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
95 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
102 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
103 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
116 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
119 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
120 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
121 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
122 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
123 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
124 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
125 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
126 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
127 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
128 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
129 2738543033 Novosphingobium sp. GV064 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.67
Metatranscriptomes 0
Isolates 2.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.81
Nodule 0
Rhizoplane 3.49
Rhizosphere 84.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10522137 3300005327 Bacteria 1027
2 JGI24739J22299_10015968 3300001989 Bacteria 2723
3 JGI24737J22298_10006756 3300001990 Bacteria 3899
4 JGI24738J21930_10068460 3300002075 Bacteria 733
5 Ga0065715_10125593 3300005293 Bacteria 2127
6 Ga0070658_10054331 3300005327 Bacteria 3252
7 Ga0070658_10224700 3300005327 Bacteria 1588
8 Ga0070658_11375484 3300005327 Bacteria 613
9 Ga0070683_101614119 3300005329 Bacteria 624
10 Ga0070677_10037862 3300005333 Bacteria 1884
11 Ga0070666_10014667 3300005335 Bacteria 4991
12 Ga0070668_100017548 3300005347 Bacteria 5367
13 Ga0070669_100024177 3300005353 Bacteria 4355
14 Ga0070669_100305568 3300005353 Bacteria 1280
15 Ga0070669_101091257 3300005353 Bacteria 687
16 Ga0070669_101353912 3300005353 Bacteria 617
17 Ga0070675_102026409 3300005354 Bacteria 531
18 Ga0070671_100017648 3300005355 Bacteria 5783
19 Ga0070671_100673327 3300005355 Bacteria 897
20 Ga0070674_100483422 3300005356 Bacteria 1028
21 Ga0070673_100125498 3300005364 Bacteria 2147
22 Ga0070659_100230468 3300005366 Bacteria 1531
23 Ga0070667_100000014 3300005367 Bacteria 241949
24 Ga0070667_100264130 3300005367 Bacteria 1542
25 Ga0070663_100482218 3300005455 Bacteria 1027
26 Ga0070678_100154836 3300005456 Bacteria 1850
27 Ga0070662_100776717 3300005457 Bacteria 813
28 Ga0070662_101789416 3300005457 Bacteria 531
29 Ga0070685_10250995 3300005466 Bacteria 1172
30 Ga0068853_100008551 3300005539 Bacteria 8225
31 Ga0068853_100289569 3300005539 Bacteria 1512
32 Ga0070672_100096298 3300005543 Bacteria 2394
33 Ga0068855_101718103 3300005563 Bacteria 639
34 Ga0068857_100073886 3300005577 Bacteria 3038
35 Ga0068857_100664581 3300005577 Bacteria 988
36 Ga0068854_100014916 3300005578 Bacteria 5131
37 Ga0068859_102937063 3300005617 Bacteria 522
38 Ga0068864_100004266 3300005618 Bacteria 11762
39 Ga0068864_100179151 3300005618 Bacteria 1937
40 Ga0068861_101675669 3300005719 Bacteria 628
41 Ga0068851_10350366 3300005834 Bacteria 859
42 Ga0068863_100000093 3300005841 Bacteria 96862
43 Ga0068863_100050732 3300005841 Bacteria 3932
44 Ga0068858_100635076 3300005842 Bacteria 1037
45 Ga0068860_100020220 3300005843 Bacteria 6452
46 Ga0068862_100391123 3300005844 Bacteria 1299
47 Ga0075367_10125922 3300006178 Bacteria 1581
48 Ga0097621_100096443 3300006237 Bacteria 2482
49 Ga0068871_100172238 3300006358 Bacteria 1856
50 Ga0068865_101075969 3300006881 Bacteria 707
51 Ga0068865_101597582 3300006881 Bacteria 586
52 Ga0097620_102936942 3300006931 Bacteria 522
53 Ga0105238_10789038 3300009551 Bacteria 965
54 Ga0105249_10731365 3300009553 Bacteria 1051
55 Ga0157371_10175615 3300013102 Bacteria 1531
56 Ga0157371_10569295 3300013102 Bacteria 841
57 Ga0157371_10577687 3300013102 Bacteria 835
58 Ga0157371_10829106 3300013102 Bacteria 698
59 Ga0157371_11447967 3300013102 Bacteria 535
60 Ga0157370_10369358 3300013104 Bacteria 1322
61 Ga0157378_13167621 3300013297 Bacteria 511
62 Ga0163162_10420965 3300013306 Bacteria 1468
63 Ga0157372_13334148 3300013307 Bacteria 511
64 Ga0157375_10122771 3300013308 Bacteria 2709
65 Ga0163163_10230540 3300014325 Bacteria 1901
66 Ga0157380_10001148 3300014326 Bacteria 17105
67 Ga0157380_12219516 3300014326 Bacteria 613
68 Ga0183363_1010 3300015690 Bacteria 108191
69 Ga0163161_10010745 3300017792 Bacteria 6342
70 Ga0163161_10024627 3300017792 Bacteria 4253
71 Ga0163161_10632378 3300017792 Bacteria 885
72 Ga0207666_1080083 3300025271 Bacteria 527
73 Ga0209257_1008677 3300025304 Bacteria 5687
74 Ga0207656_10301105 3300025321 Bacteria 794
75 Ga0207682_10162959 3300025893 Bacteria 1011
76 Ga0207680_10413580 3300025903 Bacteria 954
77 Ga0207705_10037104 3300025909 Bacteria 3487
78 Ga0207705_10086046 3300025909 Bacteria 2297
79 Ga0207705_10596910 3300025909 Bacteria 859
80 Ga0207657_11224681 3300025919 Bacteria 570
81 Ga0207681_10018794 3300025923 Bacteria 4359
82 Ga0207681_10083852 3300025923 Bacteria 2257
83 Ga0207694_10486329 3300025924 Bacteria 1033
84 Ga0207650_11703069 3300025925 Bacteria 534
85 Ga0207659_10665387 3300025926 Bacteria 890
86 Ga0207664_10403867 3300025929 Bacteria 1215
87 Ga0207644_10142142 3300025931 Bacteria 1849
88 Ga0207644_10820779 3300025931 Bacteria 778
89 Ga0207706_10198414 3300025933 Bacteria 1760
90 Ga0207706_10308690 3300025933 Bacteria 1378
91 Ga0207669_11836420 3300025937 Bacteria 518
92 Ga0207691_10088954 3300025940 Bacteria 2769
93 Ga0207711_10659100 3300025941 Bacteria 976
94 Ga0207661_11448801 3300025944 Bacteria 630
95 Ga0207667_10101239 3300025949 Bacteria 2972
96 Ga0207668_10002411 3300025972 Bacteria 10931
97 Ga0207668_11218954 3300025972 Bacteria 676
98 Ga0207640_10919376 3300025981 Bacteria 765
99 Ga0207658_10000019 3300025986 Bacteria 206335
100 Ga0207658_10487472 3300025986 Bacteria 1096
101 Ga0207703_10694147 3300026035 Bacteria 968
102 Ga0207639_10002451 3300026041 Bacteria 12445
103 Ga0207639_10196043 3300026041 Bacteria 1729
104 Ga0207639_10434369 3300026041 Bacteria 1189
105 Ga0207678_11614022 3300026067 Bacteria 571
106 Ga0207641_10000029 3300026088 Bacteria 229383
107 Ga0207641_10000207 3300026088 Bacteria 77525
108 Ga0207676_10143751 3300026095 Bacteria 2045
109 Ga0207676_11495421 3300026095 Bacteria 672
110 Ga0207674_10006677 3300026116 Bacteria 13554
111 Ga0207675_100107138 3300026118 Bacteria 2635
112 Ga0207675_101198114 3300026118 Bacteria 780
113 Ga0207683_10225680 3300026121 Bacteria 1708
114 Ga0207683_10602616 3300026121 Bacteria 1017
115 Ga0207683_11697319 3300026121 Bacteria 581
116 Ga0268265_10127482 3300028380 Bacteria 2109
117 Ga0268264_10014302 3300028381 Bacteria 6525
118 Ga0307517_10205915 3300028786 Bacteria 1221
119 Ga0307413_10170203 3300031824 Bacteria 1541
120 Ga0307412_10066973 3300031911 Bacteria 2436
121 Ga0307412_10679286 3300031911 Bacteria 881
122 Ga0307414_10053750 3300032004 Bacteria 2811
123 Ga0373946_0273049 3300035171 Bacteria 830
124 Ga0395899_0062092 3300037312 Bacteria 2751
125 Ga0395900_0014785 3300037418 Bacteria 7953
126 Ga0395900_0269093 3300037418 Bacteria 1699
127 Ga0395898_0979093 3300037466 Bacteria 782
128 Ga0395905_0001572 3300037471 Bacteria 27278
129 Ga0395905_0171283 3300037471 Bacteria 2039
130 Ga0395901_0218739 3300038443 Bacteria 1991
131 Ga0436363_1707921 3300039450 Bacteria 561
132 Ga0451843_0627582 3300041509 Bacteria 836
133 Ga0450904_021524 3300042139 Bacteria 656
134 Ga0466966_0079725 3300044684 Bacteria 2040
135 Ga0466963_0050324 3300044694 Bacteria 2758
136 Ga0466963_0983168 3300044694 Bacteria 594
137 Ga0466959_0060071 3300045049 Bacteria 2766
138 Ga0466967_0347474 3300045976 Bacteria 1435
139 Ga0466967_2074193 3300045976 Bacteria 565
140 Ga0495638_0365097 3300046460 Bacteria 758
141 Ga0495638_0521573 3300046460 Bacteria 595
142 Ga0495637_0083257 3300046520 Bacteria 1272
143 Ga0495673_0010031 3300047469 Bacteria 5188
144 Ga0495686_0000238 3300047472 Bacteria 99919
145 Ga0496101_0871662 3300048904 Bacteria 709
146 Ga0496107_0042994 3300048910 Bacteria 3246
147 Ga0496108_0657870 3300048911 Bacteria 910
148 Ga0496109_0291569 3300048912 Bacteria 1538
149 Ga0496110_0533240 3300048913 Bacteria 1067
150 Ga0496111_0033394 3300048914 Bacteria 3670
151 Ga0496122_0303747 3300048925 Bacteria 859
152 Ga0496124_0047448 3300048927 Bacteria 3675
153 Ga0496125_0149034 3300048928 Bacteria 1611
154 Ga0496125_0769708 3300048928 Bacteria 502
155 Ga0495678_114477 3300049459 Bacteria 915
156 Ga0501043_0455541 3300049579 Bacteria 960
157 Ga0501235_047471 3300049669 Bacteria 990
158 Ga0501225_0067001 3300049705 Bacteria 1016
159 Ga0501044_0614316 3300049823 Bacteria 979
160 nmdc:mga06z11_449220_c1 3300050494 Bacteria 779
161 Ga0500643_014812 3300053087 Bacteria 2693
162 Ga0500643_030481 3300053087 Bacteria 1651
163 Ga0500556_0435297 3300053104 Bacteria 500
164 Ga0500655_104879 3300053133 Bacteria 594
165 Ga0500559_0069883 3300053136 Bacteria 1579
166 Ga0500622_0337893 3300053156 Bacteria 629
167 Ga0500645_052236 3300053730 Bacteria 1191
168 Ga0466962_0253050 3300061719 Bacteria 866
169 2738848307 2738541301 Bacteria 4834102
170 2738864036 2738541304 Bacteria 4833665
171 2739296554 2738543022 Bacteria 4835059
172 2739358232 2738543033 Bacteria 4833336
173 Ga0070658_10522137
174 JGI24739J22299_10015968
175 JGI24737J22298_10006756
176 JGI24738J21930_10068460
177 Ga0065715_10125593
178 Ga0070658_10054331
179 Ga0070658_10224700
180 Ga0070658_11375484
181 Ga0070683_101614119
182 Ga0070677_10037862
183 Ga0070666_10014667
184 Ga0070668_100017548
185 Ga0070669_100024177
186 Ga0070669_100305568
187 Ga0070669_101091257
188 Ga0070669_101353912
189 Ga0070675_102026409
190 Ga0070671_100017648
191 Ga0070671_100673327
192 Ga0070674_100483422
193 Ga0070673_100125498
194 Ga0070659_100230468
195 Ga0070667_100000014
196 Ga0070667_100264130
197 Ga0070663_100482218
198 Ga0070678_100154836
199 Ga0070662_100776717
200 Ga0070662_101789416
201 Ga0070685_10250995
202 Ga0068853_100008551
203 Ga0068853_100289569
204 Ga0070672_100096298
205 Ga0068855_101718103
206 Ga0068857_100073886
207 Ga0068857_100664581
208 Ga0068854_100014916
209 Ga0068859_102937063
210 Ga0068864_100004266
211 Ga0068864_100179151
212 Ga0068861_101675669
213 Ga0068851_10350366
214 Ga0068863_100000093
215 Ga0068863_100050732
216 Ga0068858_100635076
217 Ga0068860_100020220
218 Ga0068862_100391123
219 Ga0075367_10125922
220 Ga0097621_100096443
221 Ga0068871_100172238
222 Ga0068865_101075969
223 Ga0068865_101597582
224 Ga0097620_102936942
225 Ga0105238_10789038
226 Ga0105249_10731365
227 Ga0157371_10175615
228 Ga0157371_10569295
229 Ga0157371_10577687
230 Ga0157371_10829106
231 Ga0157371_11447967
232 Ga0157370_10369358
233 Ga0157378_13167621
234 Ga0163162_10420965
235 Ga0157372_13334148
236 Ga0157375_10122771
237 Ga0163163_10230540
238 Ga0157380_10001148
239 Ga0157380_12219516
240 Ga0183363_1010
241 Ga0163161_10010745
242 Ga0163161_10024627
243 Ga0163161_10632378
244 Ga0207666_1080083
245 Ga0209257_1008677
246 Ga0207656_10301105
247 Ga0207682_10162959
248 Ga0207680_10413580
249 Ga0207705_10037104
250 Ga0207705_10086046
251 Ga0207705_10596910
252 Ga0207657_11224681
253 Ga0207681_10018794
254 Ga0207681_10083852
255 Ga0207694_10486329
256 Ga0207650_11703069
257 Ga0207659_10665387
258 Ga0207664_10403867
259 Ga0207644_10142142
260 Ga0207644_10820779
261 Ga0207706_10198414
262 Ga0207706_10308690
263 Ga0207669_11836420
264 Ga0207691_10088954
265 Ga0207711_10659100
266 Ga0207661_11448801
267 Ga0207667_10101239
268 Ga0207668_10002411
269 Ga0207668_11218954
270 Ga0207640_10919376
271 Ga0207658_10000019
272 Ga0207658_10487472
273 Ga0207703_10694147
274 Ga0207639_10002451
275 Ga0207639_10196043
276 Ga0207639_10434369
277 Ga0207678_11614022
278 Ga0207641_10000029
279 Ga0207641_10000207
280 Ga0207676_10143751
281 Ga0207676_11495421
282 Ga0207674_10006677
283 Ga0207675_100107138
284 Ga0207675_101198114
285 Ga0207683_10225680
286 Ga0207683_10602616
287 Ga0207683_11697319
288 Ga0268265_10127482
289 Ga0268264_10014302
290 Ga0307517_10205915
291 Ga0307413_10170203
292 Ga0307412_10066973
293 Ga0307412_10679286
294 Ga0307414_10053750
295 Ga0373946_0273049
296 Ga0395899_0062092
297 Ga0395900_0014785
298 Ga0395900_0269093
299 Ga0395898_0979093
300 Ga0395905_0001572
301 Ga0395905_0171283
302 Ga0395901_0218739
303 Ga0436363_1707921
304 Ga0451843_0627582
305 Ga0450904_021524
306 Ga0466966_0079725
307 Ga0466963_0050324
308 Ga0466963_0983168
309 Ga0466959_0060071
310 Ga0466967_0347474
311 Ga0466967_2074193
312 Ga0495638_0365097
313 Ga0495638_0521573
314 Ga0495637_0083257
315 Ga0495673_0010031
316 Ga0495686_0000238
317 Ga0496101_0871662
318 Ga0496107_0042994
319 Ga0496108_0657870
320 Ga0496109_0291569
321 Ga0496110_0533240
322 Ga0496111_0033394
323 Ga0496122_0303747
324 Ga0496124_0047448
325 Ga0496125_0149034
326 Ga0496125_0769708
327 Ga0495678_114477
328 Ga0501043_0455541
329 Ga0501235_047471
330 Ga0501225_0067001
331 Ga0501044_0614316
332 nmdc:mga06z11_449220_c1
333 Ga0500643_014812
334 Ga0500643_030481
335 Ga0500556_0435297
336 Ga0500655_104879
337 Ga0500559_0069883
338 Ga0500622_0337893
339 Ga0500645_052236
340 Ga0466962_0253050
341 2738848307
342 2738864036
343 2739296554
344 2739358232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01541

GIY-YIG

GIY-YIG catalytic domain

25

100

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cq3-assembly1.cif.gz_A crystal structure of slx1-slx4 0.8328 5 74
6sei-assembly1.cif.gz_C recognition and processing of branched dna substrates by slx1-slx4 nuclease 0.8103 6 72
6seh-assembly2.cif.gz_A recognition and processing of branched dna substrates by slx1-slx4 nuclease 0.7823 6 74
4xlg-assembly1.cif.gz_A c. glabrata slx1 in complex with slx4ccd. 0.7816 5 40
6seh-assembly1.cif.gz_C recognition and processing of branched dna substrates by slx1-slx4 nuclease 0.7737 6 73
ID Description Score Start End Superfamily
af_Q2G2W7_1_82_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.9241 6 86 3.40.1440.10
af_Q2G2W7_1_82_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.8926 6 86 3.40.1440.10
af_P45472_1_97_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.8626 6 97 3.40.1440.10
af_Q5A4X4_14_118_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.846 7 74 3.40.1440.10
af_A4I1H7_2_94_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.814 6 74 3.40.1440.10
ID Description Score Start End GO Terms
AF-A0A5B9YU74-F1-model_v4 deleted 0.9785 6 97
AF-A0A2D6UQU4-F1-model_v4 deleted 0.9757 7 96
AF-A0A2D4ZU43-F1-model_v4 Endonuclease 0.9757 6 97 GO:0004519
AF-A0A4R6FLQ1-F1-model_v4 Putative endonuclease 0.9752 7 98 GO:0004519
AF-A0A3M0A2K6-F1-model_v4 Putative endonuclease 0.9745 6 98 GO:0004519

Map