F259588

General Info

Members Datasets Scaffolds Average Seq Length
171 109 169 321

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_0046193|Ga0501079_0046193_1024_2130
Length 368
Sequence MKIWRKMKTRVWIALLALYIVWGSTYLAIRFAVETIPPFLQAGLRFFISGAILVIWRRLAGDEMPTGRQWKSLAIIGTLLLLGGNGLVSFAEQRIASGVAALIVGTVPLWLVLIEALRPGGVRPTWQAIAGLIVGFGGIYLLIGPSELTGGLRFDLIGTVAVIIASLLWSIGSIYSRSAELPKSALMMTGSEMLAGSIPIFIVSLFLGEWNNFSLAQVSAQSWLALLYLIAFGSMIGFVSYVWLLQNAPVSLVATYAYVNPLVAVFLGNWFAQEPLTPRTLLAAGIIIGAVVVINSARQAKAKTEARQPVPKTRTEPRRGNADYPIHRSARMFCDLTGQVHYLHRAVGKSKHKGEQDGCQGINQECQR

Samples

Sample ID Description Type Environment
1 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
2 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
57 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
64 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
65 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
66 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
70 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
71 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
72 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
73 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
74 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
75 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
76 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
77 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
78 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
89 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
90 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
91 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
92 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
93 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
94 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
95 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
99 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
100 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
104 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
105 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
106 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
107 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
108 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
109 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 2.92
Rhizosphere 94.74
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10003334 3300003203 Bacteria 7562
2 Ga0065707_10087464 3300005295 Bacteria 5013
3 Ga0070666_10009936 3300005335 Bacteria 5940
4 Ga0070680_100000029 3300005336 Bacteria 74849
5 Ga0070689_100106671 3300005340 Bacteria 2223
6 Ga0070689_100146034 3300005340 Bacteria 1905
7 Ga0070667_100007238 3300005367 Bacteria 9218
8 Ga0070709_10138398 3300005434 Bacteria 1670
9 Ga0070714_100109293 3300005435 Bacteria 2446
10 Ga0070713_100036619 3300005436 Bacteria 3960
11 Ga0070713_100069508 3300005436 Bacteria 2970
12 Ga0070710_10178431 3300005437 Bacteria 1328
13 Ga0070705_100012677 3300005440 Bacteria 4292
14 Ga0070707_100105133 3300005468 Bacteria 2738
15 Ga0070707_100298052 3300005468 Bacteria 1567
16 Ga0070698_100008907 3300005471 Bacteria 10789
17 Ga0070698_100019068 3300005471 Bacteria 7213
18 Ga0070698_100019715 3300005471 Bacteria 7074
19 Ga0070697_100047333 3300005536 Bacteria 3487
20 Ga0070695_100247093 3300005545 Unclassified 1297
21 Ga0070696_100045229 3300005546 Bacteria 3050
22 Ga0070696_100063337 3300005546 Unclassified 2590
23 Ga0070665_100001748 3300005548 Bacteria 24856
24 Ga0070704_100045441 3300005549 Unclassified 3056
25 Ga0070704_100292107 3300005549 Unclassified 1355
26 Ga0068856_100135456 3300005614 Bacteria 2468
27 Ga0070702_100109954 3300005615 Bacteria 1707
28 Ga0068859_100000695 3300005617 Bacteria 33715
29 Ga0068859_100033305 3300005617 Bacteria 5175
30 Ga0068860_100040809 3300005843 Bacteria 4434
31 Ga0068862_100227724 3300005844 Unclassified 1690
32 Ga0081455_10004171 3300005937 Bacteria 16300
33 Ga0081455_10016852 3300005937 Bacteria 7026
34 Ga0081539_10005270 3300005985 Bacteria 13334
35 Ga0070712_100015557 3300006175 Bacteria 4906
36 Ga0075427_10002697 3300006194 Unclassified 2405
37 Ga0097621_100346702 3300006237 Bacteria 1320
38 Ga0068871_100150035 3300006358 Bacteria 1987
39 Ga0075434_100004638 3300006871 Bacteria 12422
40 Ga0075429_100246168 3300006880 Bacteria 1565
41 Ga0075429_100457024 3300006880 Bacteria 1119
42 Ga0068865_100022997 3300006881 Bacteria 4075
43 Ga0097620_100000695 3300006931 Bacteria 33715
44 Ga0097620_100033305 3300006931 Bacteria 5175
45 Ga0075435_100003217 3300007076 Bacteria 11059
46 Ga0111539_10049061 3300009094 Bacteria 5038
47 Ga0114129_10041939 3300009147 Bacteria 6444
48 Ga0114129_10069500 3300009147 Bacteria 4909
49 Ga0105243_10487058 3300009148 Bacteria 1165
50 Ga0105241_10409119 3300009174 Bacteria 1192
51 Ga0157378_10246731 3300013297 Bacteria 1708
52 Ga0157380_10427761 3300014326 Bacteria 1265
53 Ga0157379_10431736 3300014968 Bacteria 1214
54 Ga0207680_10005503 3300025903 Bacteria 6053
55 Ga0207660_10000129 3300025917 Bacteria 44676
56 Ga0207700_10147809 3300025928 Bacteria 1939
57 Ga0207690_10096540 3300025932 Bacteria 2102
58 Ga0207709_10348233 3300025935 Bacteria 1117
59 Ga0207670_10074080 3300025936 Bacteria 2362
60 Ga0207691_10002378 3300025940 Bacteria 18417
61 Ga0207658_10001799 3300025986 Bacteria 16057
62 Ga0268266_10012954 3300028379 Bacteria 7191
63 Ga0268264_10145544 3300028381 Bacteria 2118
64 Ga0265327_10001690 3300031251 Bacteria 26378
65 Ga0307508_10084629 3300031616 Bacteria 2754
66 Ga0316575_10017838 3300031665 Bacteria 2700
67 Ga0316579_10064171 3300031691 Bacteria 1732
68 Ga0307412_10111016 3300031911 Bacteria 1958
69 Ga0307409_100038711 3300031995 Unclassified 3530
70 Ga0307409_100089135 3300031995 Bacteria 2521
71 Ga0307416_100028852 3300032002 Bacteria 4135
72 Ga0307415_100327891 3300032126 Bacteria 1279
73 Ga0373937_0605367 3300036401 Bacteria 1040
74 Ga0316584_0104653 3300036712 Archaea 2118
75 Ga0450919_007132 3300042121 Bacteria 1311
76 Ga0451577_0000101 3300042876 Bacteria 190854
77 Ga0451577_0000133 3300042876 Bacteria 166977
78 Ga0451577_0013722 3300042876 Bacteria 7572
79 Ga0453683_0001914 3300044673 Bacteria 16998
80 Ga0453683_0107962 3300044673 Bacteria 1749
81 Ga0453683_0192731 3300044673 Unclassified 1293
82 Ga0453684_0000180 3300044712 Bacteria 279345
83 Ga0453684_0000318 3300044712 Bacteria 203553
84 Ga0453684_0000679 3300044712 Bacteria 121950
85 Ga0453684_0000752 3300044712 Bacteria 112676
86 Ga0453684_0002471 3300044712 Bacteria 44690
87 Ga0453684_0004078 3300044712 Bacteria 31724
88 Ga0453684_0005707 3300044712 Bacteria 24370
89 Ga0453684_0027322 3300044712 Bacteria 8189
90 Ga0453684_0122599 3300044712 Bacteria 3135
91 Ga0453684_0132629 3300044712 Bacteria 2987
92 Ga0453684_0140025 3300044712 Unclassified 2891
93 Ga0453684_0162173 3300044712 Unclassified 2643
94 Ga0453684_0238007 3300044712 Unclassified 2097
95 Ga0453684_0280074 3300044712 Bacteria 1902
96 Ga0453684_0529871 3300044712 Bacteria 1300
97 Ga0453684_0656024 3300044712 Bacteria 1144
98 Ga0451576_0014448 3300045051 Bacteria 8786
99 Ga0451576_0055035 3300045051 Bacteria 4164
100 Ga0451576_0901387 3300045051 Bacteria 928
101 Ga0495608_0131973 3300046511 Bacteria 1598
102 Ga0495640_0075218 3300046533 Bacteria 2256
103 Ga0495634_0130344 3300046642 Bacteria 1604
104 Ga0495674_0144315 3300047319 Bacteria 1999
105 Ga0496101_0051320 3300048904 Bacteria 2972
106 Ga0496105_0009398 3300048908 Bacteria 7645
107 Ga0496106_0007509 3300048909 Bacteria 8058
108 Ga0496107_0024222 3300048910 Bacteria 4293
109 Ga0496111_0069868 3300048914 Bacteria 2554
110 Ga0501031_0071759 3300049568 Bacteria 2255
111 Ga0501036_0003721 3300049572 Bacteria 12227
112 Ga0501036_0006513 3300049572 Bacteria 9488
113 Ga0501038_0063101 3300049574 Bacteria 3164
114 Ga0501039_0001811 3300049575 Bacteria 15796
115 Ga0501040_0006823 3300049576 Bacteria 7402
116 Ga0501040_0099186 3300049576 Bacteria 2031
117 Ga0501041_0016535 3300049577 Bacteria 4387
118 Ga0501042_0002565 3300049578 Bacteria 11169
119 Ga0501043_0218543 3300049579 Bacteria 1475
120 Ga0501046_0074752 3300049580 Bacteria 2628
121 Ga0501046_0128614 3300049580 Bacteria 1922
122 Ga0501046_0254523 3300049580 Bacteria 1292
123 Ga0501048_0002629 3300049582 Bacteria 13740
124 Ga0501048_0020364 3300049582 Bacteria 4861
125 Ga0501068_0010421 3300049584 Bacteria 5223
126 Ga0501068_0192569 3300049584 Bacteria 1292
127 Ga0501069_0047419 3300049585 Bacteria 2385
128 Ga0501071_0009584 3300049587 Bacteria 6458
129 Ga0501071_0019781 3300049587 Bacteria 4674
130 Ga0501071_0136750 3300049587 Bacteria 1824
131 Ga0501072_0003131 3300049588 Bacteria 12442
132 Ga0501072_0022943 3300049588 Bacteria 4844
133 Ga0501072_0178087 3300049588 Bacteria 1696
134 Ga0501074_0004093 3300049590 Bacteria 10401
135 Ga0501074_0050066 3300049590 Bacteria 3016
136 Ga0501074_0065952 3300049590 Bacteria 2604
137 Ga0501074_0163340 3300049590 Bacteria 1590
138 Ga0501075_0292675 3300049591 Bacteria 1240
139 Ga0501076_0002931 3300049592 Bacteria 11823
140 Ga0501076_0005031 3300049592 Bacteria 9459
141 Ga0501076_0061037 3300049592 Bacteria 3000
142 Ga0501077_0006490 3300049593 Bacteria 7182
143 Ga0501079_0004460 3300049741 Bacteria 10379
144 Ga0501079_0046193 3300049741 Bacteria 3360
145 Ga0501079_0142237 3300049741 Bacteria 1869
146 Ga0501079_0142415 3300049741 Bacteria 1867
147 Ga0501080_0011145 3300049742 Bacteria 8231
148 Ga0501081_0002972 3300049743 Bacteria 10759
149 Ga0501081_0007035 3300049743 Bacteria 7315
150 Ga0501083_0043043 3300049744 Bacteria 3060
151 Ga0501035_0164071 3300049822 Bacteria 1922
152 Ga0501045_0001878 3300049824 Bacteria 14238
153 Ga0501045_0097259 3300049824 Bacteria 2178
154 nmdc:mga05p37_185456_c1 3300050507 Unclassified 2530
155 nmdc:mga0n895_4189_c1 3300050512 Bacteria 11780
156 Ga0495612_0024446 3300053078 Bacteria 2425
157 Ga0495619_0102921 3300053085 Bacteria 1945
158 Ga0500559_0060214 3300053136 Bacteria 1691
159 Ga0501084_0005688 3300054114 Bacteria 10239
160 Ga0501084_0164034 3300054114 Bacteria 1875
161 Ga0501084_0173279 3300054114 Bacteria 1821
162 Ga0501084_0201228 3300054114 Bacteria 1680
163 Ga0501082_0071958 3300060353 Bacteria 2978
164 Ga0501082_0115849 3300060353 Bacteria 2321
165 Ga0501082_0128023 3300060353 Unclassified 2203
166 Ga0501082_0140997 3300060353 Bacteria 2092
167 Ga0501082_0146431 3300060353 Bacteria 2050
168 Ga0530510_0003875 3300061734 Bacteria 10314
169 Ga0530510_0050126 3300061734 Bacteria 3015

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0104653 Ga0316584_0104653_11_877 255
2 3300047319 Ga0495674_0144315 Ga0495674_0144315_488_1420 276
3 3300053078 Ga0495612_0024446 Ga0495612_0024446_726_1658 276
4 3300053085 Ga0495619_0102921 Ga0495619_0102921_875_1807 276
5 3300005937 Ga0081455_10016852 Ga0081455_100168524 277
6 3300044712 Ga0453684_0122599 Ga0453684_0122599_1111_2073 277
7 3300045051 Ga0451576_0901387 Ga0451576_0901387_46_918 277
8 3300049588 Ga0501072_0178087 Ga0501072_0178087_354_1343 277
9 3300049824 Ga0501045_0097259 Ga0501045_0097259_22_1011 277
10 3300054114 Ga0501084_0164034 Ga0501084_0164034_105_1094 277
11 3300044712 Ga0453684_0162173 Ga0453684_0162173_600_1556 280
12 3300031616 Ga0307508_10084629 Ga0307508_100846292 284
13 3300005435 Ga0070714_100109293 Ga0070714_1001092933 285
14 3300006175 Ga0070712_100015557 Ga0070712_1000155576 285
15 3300031665 Ga0316575_10017838 Ga0316575_100178382 286
16 3300005536 Ga0070697_100047333 Ga0070697_1000473334 287
17 3300005434 Ga0070709_10138398 Ga0070709_101383982 289
18 3300005436 Ga0070713_100036619 Ga0070713_1000366196 289
19 3300005437 Ga0070710_10178431 Ga0070710_101784311 289
20 3300036401 Ga0373937_0605367 Ga0373937_0605367_56_988 289
21 3300044712 Ga0453684_0656024 Ga0453684_0656024_79_1005 289
22 3300046511 Ga0495608_0131973 Ga0495608_0131973_179_1111 289
23 3300046533 Ga0495640_0075218 Ga0495640_0075218_372_1304 289
24 3300046642 Ga0495634_0130344 Ga0495634_0130344_417_1349 289
25 3300048904 Ga0496101_0051320 Ga0496101_0051320_1312_2244 289
26 3300048908 Ga0496105_0009398 Ga0496105_0009398_5381_6313 289
27 3300005336 Ga0070680_100000029 Ga0070680_10000002916 290
28 3300025917 Ga0207660_10000129 Ga0207660_1000012918 290
29 3300031251 Ga0265327_10001690 Ga0265327_1000169017 290
30 iso_pu_bacteria 2894510363 2894513637 291
31 iso_pu_bacteria 2989392574 2989394757 291
32 3300005436 Ga0070713_100069508 Ga0070713_1000695084 292
33 3300005937 Ga0081455_10004171 Ga0081455_1000417114 292
34 3300025928 Ga0207700_10147809 Ga0207700_101478092 292
35 3300049592 Ga0501076_0061037 Ga0501076_0061037_434_1441 292
36 3300049741 Ga0501079_0142237 Ga0501079_0142237_359_1324 292
37 3300053136 Ga0500559_0060214 Ga0500559_0060214_649_1620 292
38 3300054114 Ga0501084_0173279 Ga0501084_0173279_690_1697 292
39 3300005295 Ga0065707_10087464 Ga0065707_100874641 293
40 3300049572 Ga0501036_0003721 Ga0501036_0003721_8556_9548 293
41 3300049574 Ga0501038_0063101 Ga0501038_0063101_291_1283 293
42 3300049575 Ga0501039_0001811 Ga0501039_0001811_6088_7080 293
43 3300049576 Ga0501040_0006823 Ga0501040_0006823_1959_2951 293
44 3300049578 Ga0501042_0002565 Ga0501042_0002565_8501_9493 293
45 3300049579 Ga0501043_0218543 Ga0501043_0218543_85_1077 293
46 3300049580 Ga0501046_0074752 Ga0501046_0074752_49_1041 293
47 3300049582 Ga0501048_0020364 Ga0501048_0020364_3230_4222 293
48 3300049584 Ga0501068_0010421 Ga0501068_0010421_2499_3491 293
49 3300049587 Ga0501071_0019781 Ga0501071_0019781_1831_2823 293
50 3300049588 Ga0501072_0003131 Ga0501072_0003131_4799_5791 293
51 3300049590 Ga0501074_0004093 Ga0501074_0004093_8936_9928 293
52 3300049592 Ga0501076_0002931 Ga0501076_0002931_9097_10089 293
53 3300049593 Ga0501077_0006490 Ga0501077_0006490_550_1542 293
54 3300049741 Ga0501079_0004460 Ga0501079_0004460_7935_8927 293
55 3300049743 Ga0501081_0002972 Ga0501081_0002972_7745_8737 293
56 3300049744 Ga0501083_0043043 Ga0501083_0043043_1234_2226 293
57 3300050512 nmdc:mga0n895_4189_c1 nmdc:mga0n895_4189_c1_9726_10700 293
58 3300054114 Ga0501084_0005688 Ga0501084_0005688_1899_2891 293
59 3300061734 Ga0530510_0003875 Ga0530510_0003875_9171_10163 293
60 3300005340 Ga0070689_100146034 Ga0070689_1001460341 294
61 3300005440 Ga0070705_100012677 Ga0070705_1000126774 294
62 3300005468 Ga0070707_100105133 Ga0070707_1001051332 294
63 3300005471 Ga0070698_100019068 Ga0070698_1000190682 294
64 3300005471 Ga0070698_100019715 Ga0070698_1000197159 294
65 3300005545 Ga0070695_100247093 Ga0070695_1002470931 294
66 3300005546 Ga0070696_100045229 Ga0070696_1000452293 294
67 3300005546 Ga0070696_100063337 Ga0070696_1000633373 294
68 3300005549 Ga0070704_100045441 Ga0070704_1000454413 294
69 3300005617 Ga0068859_100033305 Ga0068859_1000333053 294
70 3300006871 Ga0075434_100004638 Ga0075434_1000046383 294
71 3300006931 Ga0097620_100033305 Ga0097620_1000333055 294
72 3300007076 Ga0075435_100003217 Ga0075435_1000032172 294
73 3300009147 Ga0114129_10069500 Ga0114129_100695002 294
74 3300025932 Ga0207690_10096540 Ga0207690_100965402 294
75 3300028381 Ga0268264_10145544 Ga0268264_101455441 294
76 3300042121 Ga0450919_007132 Ga0450919_007132_281_1282 294
77 3300049568 Ga0501031_0071759 Ga0501031_0071759_364_1395 294
78 3300049572 Ga0501036_0006513 Ga0501036_0006513_8180_9211 294
79 3300049576 Ga0501040_0099186 Ga0501040_0099186_715_1716 294
80 3300049577 Ga0501041_0016535 Ga0501041_0016535_3119_4126 294
81 3300049580 Ga0501046_0128614 Ga0501046_0128614_151_1182 294
82 3300049580 Ga0501046_0254523 Ga0501046_0254523_107_1096 294
83 3300049582 Ga0501048_0002629 Ga0501048_0002629_734_1765 294
84 3300049584 Ga0501068_0192569 Ga0501068_0192569_247_1248 294
85 3300049587 Ga0501071_0009584 Ga0501071_0009584_4880_5911 294
86 3300049588 Ga0501072_0022943 Ga0501072_0022943_3774_4805 294
87 3300049590 Ga0501074_0050066 Ga0501074_0050066_287_1282 294
88 3300049590 Ga0501074_0065952 Ga0501074_0065952_740_1744 294
89 3300049591 Ga0501075_0292675 Ga0501075_0292675_181_1212 294
90 3300049592 Ga0501076_0005031 Ga0501076_0005031_145_1176 294
91 3300049741 Ga0501079_0142415 Ga0501079_0142415_474_1505 294
92 3300049742 Ga0501080_0011145 Ga0501080_0011145_7048_8079 294
93 3300049743 Ga0501081_0007035 Ga0501081_0007035_5664_6695 294
94 3300049822 Ga0501035_0164071 Ga0501035_0164071_702_1733 294
95 3300049824 Ga0501045_0001878 Ga0501045_0001878_5600_6631 294
96 3300054114 Ga0501084_0201228 Ga0501084_0201228_387_1418 294
97 3300060353 Ga0501082_0071958 Ga0501082_0071958_339_1340 294
98 3300060353 Ga0501082_0115849 Ga0501082_0115849_399_1394 294
99 3300060353 Ga0501082_0128023 Ga0501082_0128023_926_1912 294
100 3300060353 Ga0501082_0146431 Ga0501082_0146431_181_1212 294
101 3300061734 Ga0530510_0050126 Ga0530510_0050126_20_1015 294
102 3300042876 Ga0451577_0000101 Ga0451577_0000101_105449_106369 295
103 3300042876 Ga0451577_0000133 Ga0451577_0000133_4633_5553 295
104 3300044712 Ga0453684_0000180 Ga0453684_0000180_136228_137148 295
105 3300044712 Ga0453684_0000318 Ga0453684_0000318_71635_72603 295
106 3300044712 Ga0453684_0000679 Ga0453684_0000679_67423_68343 295
107 3300044712 Ga0453684_0027322 Ga0453684_0027322_1442_2362 295
108 3300005335 Ga0070666_10009936 Ga0070666_100099366 296
109 3300005340 Ga0070689_100106671 Ga0070689_1001066712 296
110 3300005367 Ga0070667_100007238 Ga0070667_1000072382 296
111 3300005548 Ga0070665_100001748 Ga0070665_10000174813 296
112 3300005614 Ga0068856_100135456 Ga0068856_1001354562 296
113 3300005615 Ga0070702_100109954 Ga0070702_1001099541 296
114 3300005617 Ga0068859_100000695 Ga0068859_10000069527 296
115 3300005843 Ga0068860_100040809 Ga0068860_1000408092 296
116 3300006194 Ga0075427_10002697 Ga0075427_100026972 296
117 3300006237 Ga0097621_100346702 Ga0097621_1003467022 296
118 3300006358 Ga0068871_100150035 Ga0068871_1001500352 296
119 3300006880 Ga0075429_100246168 Ga0075429_1002461682 296
120 3300006881 Ga0068865_100022997 Ga0068865_1000229971 296
121 3300006931 Ga0097620_100000695 Ga0097620_10000069527 296
122 3300009147 Ga0114129_10041939 Ga0114129_100419392 296
123 3300009174 Ga0105241_10409119 Ga0105241_104091192 296
124 3300013297 Ga0157378_10246731 Ga0157378_102467312 296
125 3300014968 Ga0157379_10431736 Ga0157379_104317361 296
126 3300025903 Ga0207680_10005503 Ga0207680_100055033 296
127 3300025936 Ga0207670_10074080 Ga0207670_100740802 296
128 3300025940 Ga0207691_10002378 Ga0207691_1000237810 296
129 3300025986 Ga0207658_10001799 Ga0207658_100017996 296
130 3300028379 Ga0268266_10012954 Ga0268266_100129546 296
131 3300044712 Ga0453684_0140025 Ga0453684_0140025_1109_2038 296
132 3300044712 Ga0453684_0529871 Ga0453684_0529871_301_1227 296
133 3300045051 Ga0451576_0055035 Ga0451576_0055035_1009_1935 296
134 3300048909 Ga0496106_0007509 Ga0496106_0007509_6781_7770 296
135 3300048910 Ga0496107_0024222 Ga0496107_0024222_2978_3967 296
136 3300048914 Ga0496111_0069868 Ga0496111_0069868_1551_2540 296
137 3300050507 nmdc:mga05p37_185456_c1 nmdc:mga05p37_185456_c1_58_987 296
138 3300009094 Ga0111539_10049061 Ga0111539_100490616 297
139 3300031995 Ga0307409_100089135 Ga0307409_1000891352 297
140 3300042876 Ga0451577_0013722 Ga0451577_0013722_1881_2810 297
141 3300044673 Ga0453683_0001914 Ga0453683_0001914_13370_14302 297
142 3300044673 Ga0453683_0107962 Ga0453683_0107962_633_1565 297
143 3300044673 Ga0453683_0192731 Ga0453683_0192731_180_1115 297
144 3300044712 Ga0453684_0002471 Ga0453684_0002471_4697_5626 297
145 3300044712 Ga0453684_0004078 Ga0453684_0004078_6535_7467 297
146 3300044712 Ga0453684_0005707 Ga0453684_0005707_17284_18213 297
147 3300044712 Ga0453684_0132629 Ga0453684_0132629_821_1774 297
148 3300044712 Ga0453684_0238007 Ga0453684_0238007_712_1641 297
149 3300044712 Ga0453684_0280074 Ga0453684_0280074_774_1718 297
150 3300045051 Ga0451576_0014448 Ga0451576_0014448_1075_2007 297
151 3300049585 Ga0501069_0047419 Ga0501069_0047419_1197_2192 297
152 3300003203 JGI25406J46586_10003334 JGI25406J46586_100033343 298
153 3300005468 Ga0070707_100298052 Ga0070707_1002980522 298
154 3300005471 Ga0070698_100008907 Ga0070698_1000089074 298
155 3300005549 Ga0070704_100292107 Ga0070704_1002921072 298
156 3300005844 Ga0068862_100227724 Ga0068862_1002277242 298
157 3300005985 Ga0081539_10005270 Ga0081539_100052706 298
158 3300006880 Ga0075429_100457024 Ga0075429_1004570241 298
159 3300009148 Ga0105243_10487058 Ga0105243_104870582 298
160 3300014326 Ga0157380_10427761 Ga0157380_104277612 298
161 3300025935 Ga0207709_10348233 Ga0207709_103482331 298
162 3300031691 Ga0316579_10064171 Ga0316579_100641712 298
163 3300031911 Ga0307412_10111016 Ga0307412_101110162 298
164 3300031995 Ga0307409_100038711 Ga0307409_1000387112 298
165 3300032002 Ga0307416_100028852 Ga0307416_1000288522 298
166 3300032126 Ga0307415_100327891 Ga0307415_1003278912 298
167 3300044712 Ga0453684_0000752 Ga0453684_0000752_107405_108340 298
168 3300049587 Ga0501071_0136750 Ga0501071_0136750_152_1105 298
169 3300049590 Ga0501074_0163340 Ga0501074_0163340_467_1420 298
170 3300049741 Ga0501079_0046193 Ga0501079_0046193_1024_2130 298
171 3300060353 Ga0501082_0140997 Ga0501082_0140997_104_1057 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

9

144

0.97

PF00892

EamA

EamA-like transporter family

156

296

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i20-assembly4.cif.gz_D crystal structure of protein 0.7965 3 278
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7864 5 280
5i20-assembly2.cif.gz_B crystal structure of protein 0.7863 3 279
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7827 2 279
7b0k-assembly1.cif.gz_A membrane protein structure 0.7681 5 280
ID Description Score Start End Superfamily
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7345 12 279 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6969 1 277 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6719 4 279 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6659 12 279 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6523 1 277 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A1F8TTV4-F1-model_v4 EamA domain-containing protein 0.9876 1 266 GO:0016020
AF-A0A1F8TTV4-F1-model_v4 EamA domain-containing protein 0.9767 1 266 GO:0016020
AF-A0A533YM13-F1-model_v4 EamA domain-containing protein 0.9761 1 255 GO:0016020
AF-A0A2M8NQG6-F1-model_v4 EamA domain-containing protein 0.9709 1 252 GO:0016020
AF-A0A4Y3PHI5-F1-model_v4 Drug/metabolite exporter YedA 0.9687 3 267 GO:0016020

Feature Viewer

pLDDT pTM Quality
84.37 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map