F259289
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 171 | 139 | 342 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300044842|Ga0466957_0005377|Ga0466957_0005377_3674_4552 |
| Length | 292 |
| Sequence | LLEAKNKAARLQALQGSVEEHTMKKEIRIFFTAMMFLTRLPVPRFTDHSPEYLEKSPRYFPLIGYMVAATSALAFLIFNKYVSEDIAIAASIIAGILTTGAFHEDGFADVCDAFGGGWTKEKILTIMKDSRLGSYGVIGMIAILSTKFLLLRELPKFTPDMGHASMNIFYNYRYFLVTLIAAHAVSRLMPVLVMCFYEYAADPDGSKSKPVATRKPGMLELLVPIGTALVPFIFLHPVFLLAIAPVIYIAFSLARYFKKWIGGYTGDCLGAIQQVSELTFYLGTIIIWRYLI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 21 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 25 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 27 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 28 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 29 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 45 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 46 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 48 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 70 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 71 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 72 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 73 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 74 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 75 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 76 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 77 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 78 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 79 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 80 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 81 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 82 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 83 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 84 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 85 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 86 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 87 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 88 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 89 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 90 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 91 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 92 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 99 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 100 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 101 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 102 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 103 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 104 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 105 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 106 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 107 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 108 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 109 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 110 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 111 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 112 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 113 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 114 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 115 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 116 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 117 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 118 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 119 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 120 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 121 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 122 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 123 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 124 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 125 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 126 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 127 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 128 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 129 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 130 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 131 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 132 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 133 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 134 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 135 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 136 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 137 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 138 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 139 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.72 |
| Metatranscriptomes | 0 |
| Isolates | 12.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.36 |
| Nodule | 0.58 |
| Rhizoplane | 0 |
| Rhizosphere | 76.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466957_0005377 | 3300044842 | Bacteria | 7188 |
| 2 | JGI24736J21556_1001238 | 3300001904 | Bacteria | 4690 |
| 3 | JGI24744J21845_10002906 | 3300002077 | Bacteria | 3502 |
| 4 | rootH1_10001457 | 3300003316 | Bacteria | 3827 |
| 5 | rootH1_10062859 | 3300003316 | Bacteria | 4243 |
| 6 | rootL2_10039916 | 3300003322 | Bacteria | 2163 |
| 7 | rootL2_10126538 | 3300003322 | Bacteria | 2580 |
| 8 | rootH1_10040060 | 3300003323 | Bacteria | 9733 |
| 9 | JGI25160J50197_1000897 | 3300003354 | Bacteria | 15662 |
| 10 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 11 | Ga0065714_10002556 | 3300005288 | Bacteria | 21413 |
| 12 | Ga0070676_10000197 | 3300005328 | Bacteria | 25353 |
| 13 | Ga0068869_100064109 | 3300005334 | Bacteria | 2702 |
| 14 | Ga0070660_100006514 | 3300005339 | Bacteria | 8099 |
| 15 | Ga0070671_100005341 | 3300005355 | Bacteria | 10243 |
| 16 | Ga0070659_100329570 | 3300005366 | Bacteria | 1277 |
| 17 | Ga0070678_100005787 | 3300005456 | Bacteria | 7194 |
| 18 | Ga0070662_100000068 | 3300005457 | Bacteria | 56624 |
| 19 | Ga0070662_100216296 | 3300005457 | Bacteria | 1527 |
| 20 | Ga0068867_100000938 | 3300005459 | Bacteria | 19833 |
| 21 | Ga0068853_100059217 | 3300005539 | Bacteria | 3308 |
| 22 | Ga0068853_100547060 | 3300005539 | Bacteria | 1096 |
| 23 | Ga0068855_100002264 | 3300005563 | Bacteria | 23750 |
| 24 | Ga0068855_100034572 | 3300005563 | Bacteria | 6026 |
| 25 | Ga0068857_100079221 | 3300005577 | Bacteria | 2933 |
| 26 | Ga0068854_100002464 | 3300005578 | Bacteria | 11457 |
| 27 | Ga0068856_100003903 | 3300005614 | Bacteria | 14952 |
| 28 | Ga0068856_100335208 | 3300005614 | Bacteria | 1530 |
| 29 | Ga0068852_100000852 | 3300005616 | Bacteria | 20278 |
| 30 | Ga0075366_10273846 | 3300006195 | Bacteria | 1031 |
| 31 | Ga0097621_100000152 | 3300006237 | Bacteria | 42727 |
| 32 | Ga0068871_100000229 | 3300006358 | Bacteria | 39643 |
| 33 | Ga0068871_100039189 | 3300006358 | Bacteria | 3790 |
| 34 | Ga0068865_100000505 | 3300006881 | Bacteria | 21848 |
| 35 | Ga0079104_1013584 | 3300006946 | Bacteria | 2500 |
| 36 | Ga0105250_10013838 | 3300009092 | Bacteria | 3323 |
| 37 | Ga0105240_10023021 | 3300009093 | Bacteria | 8250 |
| 38 | Ga0114129_10040922 | 3300009147 | Bacteria | 6531 |
| 39 | Ga0105241_10001074 | 3300009174 | Bacteria | 20835 |
| 40 | Ga0105241_10005347 | 3300009174 | Bacteria | 9486 |
| 41 | Ga0105242_10008805 | 3300009176 | Bacteria | 7743 |
| 42 | Ga0105237_10000356 | 3300009545 | Bacteria | 64629 |
| 43 | Ga0105237_10014504 | 3300009545 | Bacteria | 8237 |
| 44 | Ga0105238_10050370 | 3300009551 | Bacteria | 4193 |
| 45 | Ga0105238_10074815 | 3300009551 | Bacteria | 3380 |
| 46 | Ga0105239_10001183 | 3300010375 | Bacteria | 35762 |
| 47 | Ga0105239_10018238 | 3300010375 | Bacteria | 7758 |
| 48 | Ga0105239_10030727 | 3300010375 | Bacteria | 5908 |
| 49 | Ga0105239_10106129 | 3300010375 | Bacteria | 3111 |
| 50 | Ga0105246_10254095 | 3300011119 | Bacteria | 1397 |
| 51 | Ga0105246_10317169 | 3300011119 | Bacteria | 1265 |
| 52 | Ga0157371_10173736 | 3300013102 | Bacteria | 1540 |
| 53 | Ga0157374_10000206 | 3300013296 | Bacteria | 54254 |
| 54 | Ga0157374_10001305 | 3300013296 | Bacteria | 21219 |
| 55 | Ga0157378_10018255 | 3300013297 | Bacteria | 6157 |
| 56 | Ga0157378_10087013 | 3300013297 | Bacteria | 2833 |
| 57 | Ga0157378_10356896 | 3300013297 | Bacteria | 1430 |
| 58 | Ga0163162_10013498 | 3300013306 | Bacteria | 7974 |
| 59 | Ga0157372_10093543 | 3300013307 | Bacteria | 3421 |
| 60 | Ga0157372_10293379 | 3300013307 | Bacteria | 1891 |
| 61 | Ga0157372_10379716 | 3300013307 | Bacteria | 1647 |
| 62 | Ga0157375_10035473 | 3300013308 | Bacteria | 4761 |
| 63 | Ga0157375_10042059 | 3300013308 | Unclassified | 4419 |
| 64 | Ga0157375_10242414 | 3300013308 | Bacteria | 1962 |
| 65 | Ga0182006_1012663 | 3300015261 | Bacteria | 3684 |
| 66 | Ga0182007_10076965 | 3300015262 | Bacteria | 1094 |
| 67 | Ga0163161_10454785 | 3300017792 | Bacteria | 1036 |
| 68 | Ga0213872_10011089 | 3300021361 | Bacteria | 4272 |
| 69 | Ga0207426_1000059 | 3300025302 | Bacteria | 363842 |
| 70 | Ga0207647_10001659 | 3300025904 | Bacteria | 17144 |
| 71 | Ga0207645_10001018 | 3300025907 | Bacteria | 23159 |
| 72 | Ga0207654_10001511 | 3300025911 | Bacteria | 12268 |
| 73 | Ga0207695_10002178 | 3300025913 | Bacteria | 29621 |
| 74 | Ga0207695_10033242 | 3300025913 | Bacteria | 5629 |
| 75 | Ga0207671_10040094 | 3300025914 | Bacteria | 3467 |
| 76 | Ga0207671_10067068 | 3300025914 | Bacteria | 2672 |
| 77 | Ga0207644_10010690 | 3300025931 | Bacteria | 6052 |
| 78 | Ga0207690_10386107 | 3300025932 | Bacteria | 1114 |
| 79 | Ga0207706_10000126 | 3300025933 | Bacteria | 82630 |
| 80 | Ga0207706_10241910 | 3300025933 | Bacteria | 1578 |
| 81 | Ga0207704_10000209 | 3300025938 | Bacteria | 29657 |
| 82 | Ga0207667_10038889 | 3300025949 | Bacteria | 5074 |
| 83 | Ga0207651_10082657 | 3300025960 | Bacteria | 2319 |
| 84 | Ga0207640_10014649 | 3300025981 | Bacteria | 4517 |
| 85 | Ga0207658_10192457 | 3300025986 | Bacteria | 1697 |
| 86 | Ga0207703_10420380 | 3300026035 | Bacteria | 1244 |
| 87 | Ga0207639_10041781 | 3300026041 | Bacteria | 3433 |
| 88 | Ga0207639_10841780 | 3300026041 | Bacteria | 856 |
| 89 | Ga0207702_10083110 | 3300026078 | Bacteria | 2785 |
| 90 | Ga0207702_10164793 | 3300026078 | Bacteria | 2027 |
| 91 | Ga0207702_10207012 | 3300026078 | Bacteria | 1822 |
| 92 | Ga0207648_10000155 | 3300026089 | Bacteria | 69524 |
| 93 | Ga0207674_10121763 | 3300026116 | Bacteria | 2576 |
| 94 | Ga0207683_10012596 | 3300026121 | Bacteria | 7213 |
| 95 | Ga0207698_10009588 | 3300026142 | Bacteria | 6183 |
| 96 | Ga0307513_10097047 | 3300031456 | Bacteria | 2983 |
| 97 | Ga0307508_10000518 | 3300031616 | Bacteria | 46205 |
| 98 | Ga0307508_10248075 | 3300031616 | Bacteria | 1377 |
| 99 | Ga0307516_10331080 | 3300031730 | Bacteria | 1192 |
| 100 | Ga0373936_0049453 | 3300035113 | Bacteria | 1698 |
| 101 | Ga0400483_029993 | 3300039062 | Bacteria | 14194 |
| 102 | Ga0400483_210060 | 3300039062 | Bacteria | 6914 |
| 103 | Ga0400489_62215 | 3300039093 | Bacteria | 5690 |
| 104 | Ga0436361_0849165 | 3300039447 | Bacteria | 5333 |
| 105 | Ga0439466_0116639 | 3300041411 | Bacteria | 826 |
| 106 | Ga0439431_0004687 | 3300041997 | Bacteria | 3008 |
| 107 | Ga0439442_001255 | 3300042002 | Bacteria | 5041 |
| 108 | Ga0439449_0010955 | 3300042007 | Bacteria | 3422 |
| 109 | Ga0439454_028640 | 3300042011 | Bacteria | 862 |
| 110 | Ga0439457_002830 | 3300042014 | Bacteria | 4845 |
| 111 | Ga0439462_0002758 | 3300042015 | Bacteria | 4125 |
| 112 | Ga0450898_012309 | 3300042134 | Bacteria | 1412 |
| 113 | Ga0439434_0039469 | 3300042435 | Bacteria | 1449 |
| 114 | Ga0451577_0017788 | 3300042876 | Bacteria | 6559 |
| 115 | Ga0466969_0024874 | 3300044656 | Bacteria | 3079 |
| 116 | Ga0466972_0000026 | 3300044658 | Bacteria | 184739 |
| 117 | Ga0466972_0002405 | 3300044658 | Bacteria | 9228 |
| 118 | Ga0466966_0000038 | 3300044684 | Bacteria | 97255 |
| 119 | Ga0466970_0003659 | 3300044765 | Bacteria | 7503 |
| 120 | Ga0466960_0092717 | 3300044901 | Bacteria | 1542 |
| 121 | Ga0466959_0000421 | 3300045049 | Bacteria | 24705 |
| 122 | Ga0495627_000178 | 3300046453 | Bacteria | 72186 |
| 123 | Ga0495654_0000099 | 3300046530 | Bacteria | 98758 |
| 124 | Ga0495633_0000108 | 3300046558 | Bacteria | 111235 |
| 125 | Ga0495668_0001528 | 3300046616 | Bacteria | 21968 |
| 126 | Ga0495687_000762 | 3300047443 | Bacteria | 34827 |
| 127 | Ga0495686_0003382 | 3300047472 | Bacteria | 13888 |
| 128 | Ga0501043_0100249 | 3300049579 | Bacteria | 2277 |
| 129 | Ga0501047_0077107 | 3300049581 | Bacteria | 3207 |
| 130 | Ga0501219_000020 | 3300049703 | Bacteria | 25032 |
| 131 | Ga0501225_0103041 | 3300049705 | Bacteria | 835 |
| 132 | Ga0501241_007980 | 3300049758 | Bacteria | 1938 |
| 133 | Ga0501035_0445386 | 3300049822 | Bacteria | 1072 |
| 134 | Ga0501044_0092923 | 3300049823 | Bacteria | 3042 |
| 135 | Ga0501284_00030 | 3300050005 | Bacteria | 71858 |
| 136 | nmdc:mga05p37_10942_c1 | 3300050507 | Bacteria | 10772 |
| 137 | nmdc:mga05p37_173318_c1 | 3300050507 | Bacteria | 2630 |
| 138 | Ga0500578_0000469 | 3300053086 | Bacteria | 49263 |
| 139 | Ga0500644_0012507 | 3300053088 | Bacteria | 2349 |
| 140 | Ga0500583_0000182 | 3300053092 | Bacteria | 25516 |
| 141 | Ga0500583_0001941 | 3300053092 | Bacteria | 6072 |
| 142 | Ga0500651_0190667 | 3300053093 | Bacteria | 1214 |
| 143 | Ga0500618_000756 | 3300053125 | Bacteria | 18284 |
| 144 | Ga0500658_0104544 | 3300053134 | Bacteria | 1240 |
| 145 | Ga0500604_0081409 | 3300053151 | Bacteria | 1046 |
| 146 | Ga0500616_0051497 | 3300053153 | Bacteria | 2169 |
| 147 | Ga0500622_0036043 | 3300053156 | Bacteria | 2587 |
| 148 | Ga0500637_0204527 | 3300053178 | Bacteria | 1123 |
| 149 | Ga0500584_122880 | 3300053726 | Bacteria | 1025 |
| 150 | Ga0466962_0083746 | 3300061719 | Bacteria | 1526 |
| 151 | 2511384975 | 2511231026 | Bacteria | 5225445 |
| 152 | 2521557915 | 2521172590 | Bacteria | 5047645 |
| 153 | 2553003038 | 2551306416 | Bacteria | 6152985 |
| 154 | 2586209673 | 2585427687 | Bacteria | 5544917 |
| 155 | 2587941907 | 2585428115 | Bacteria | 4420269 |
| 156 | 2738725845 | 2738541278 | Bacteria | 9755573 |
| 157 | 2765569035 | 2765235838 | Bacteria | 5445269 |
| 158 | 2808984457 | 2808606386 | Bacteria | 4471946 |
| 159 | 2819586623 | 2818991444 | Bacteria | 6968812 |
| 160 | 2819614944 | 2818991449 | Bacteria | 5518009 |
| 161 | 2883071784 | 2883068021 | Bacteria | 6192739 |
| 162 | 2904441318 | 2904439833 | Bacteria | 5931679 |
| 163 | 2904531742 | 2904530477 | Bacteria | 5876334 |
| 164 | 2904588033 | 2904584206 | Bacteria | 6028872 |
| 165 | 2904589807 | 2904589729 | Bacteria | 6113573 |
| 166 | 2904602807 | 2904601388 | Bacteria | 5884906 |
| 167 | 2911142089 | 2911138879 | Bacteria | 5811561 |
| 168 | 2919046378 | 2919046199 | Bacteria | 5567169 |
| 169 | 2919079689 | 2919079590 | Bacteria | 5946433 |
| 170 | 2919399670 | 2919399522 | Bacteria | 5164947 |
| 171 | 2923511150 | 2923510766 | Bacteria | 5926163 |
| 172 | Ga0466957_0005377 | |||
| 173 | JGI24736J21556_1001238 | |||
| 174 | JGI24744J21845_10002906 | |||
| 175 | rootH1_10001457 | |||
| 176 | rootH1_10062859 | |||
| 177 | rootL2_10039916 | |||
| 178 | rootL2_10126538 | |||
| 179 | rootH1_10040060 | |||
| 180 | JGI25160J50197_1000897 | |||
| 181 | Ga0055538_1000002 | |||
| 182 | Ga0065714_10002556 | |||
| 183 | Ga0070676_10000197 | |||
| 184 | Ga0068869_100064109 | |||
| 185 | Ga0070660_100006514 | |||
| 186 | Ga0070671_100005341 | |||
| 187 | Ga0070659_100329570 | |||
| 188 | Ga0070678_100005787 | |||
| 189 | Ga0070662_100000068 | |||
| 190 | Ga0070662_100216296 | |||
| 191 | Ga0068867_100000938 | |||
| 192 | Ga0068853_100059217 | |||
| 193 | Ga0068853_100547060 | |||
| 194 | Ga0068855_100002264 | |||
| 195 | Ga0068855_100034572 | |||
| 196 | Ga0068857_100079221 | |||
| 197 | Ga0068854_100002464 | |||
| 198 | Ga0068856_100003903 | |||
| 199 | Ga0068856_100335208 | |||
| 200 | Ga0068852_100000852 | |||
| 201 | Ga0075366_10273846 | |||
| 202 | Ga0097621_100000152 | |||
| 203 | Ga0068871_100000229 | |||
| 204 | Ga0068871_100039189 | |||
| 205 | Ga0068865_100000505 | |||
| 206 | Ga0079104_1013584 | |||
| 207 | Ga0105250_10013838 | |||
| 208 | Ga0105240_10023021 | |||
| 209 | Ga0114129_10040922 | |||
| 210 | Ga0105241_10001074 | |||
| 211 | Ga0105241_10005347 | |||
| 212 | Ga0105242_10008805 | |||
| 213 | Ga0105237_10000356 | |||
| 214 | Ga0105237_10014504 | |||
| 215 | Ga0105238_10050370 | |||
| 216 | Ga0105238_10074815 | |||
| 217 | Ga0105239_10001183 | |||
| 218 | Ga0105239_10018238 | |||
| 219 | Ga0105239_10030727 | |||
| 220 | Ga0105239_10106129 | |||
| 221 | Ga0105246_10254095 | |||
| 222 | Ga0105246_10317169 | |||
| 223 | Ga0157371_10173736 | |||
| 224 | Ga0157374_10000206 | |||
| 225 | Ga0157374_10001305 | |||
| 226 | Ga0157378_10018255 | |||
| 227 | Ga0157378_10087013 | |||
| 228 | Ga0157378_10356896 | |||
| 229 | Ga0163162_10013498 | |||
| 230 | Ga0157372_10093543 | |||
| 231 | Ga0157372_10293379 | |||
| 232 | Ga0157372_10379716 | |||
| 233 | Ga0157375_10035473 | |||
| 234 | Ga0157375_10042059 | |||
| 235 | Ga0157375_10242414 | |||
| 236 | Ga0182006_1012663 | |||
| 237 | Ga0182007_10076965 | |||
| 238 | Ga0163161_10454785 | |||
| 239 | Ga0213872_10011089 | |||
| 240 | Ga0207426_1000059 | |||
| 241 | Ga0207647_10001659 | |||
| 242 | Ga0207645_10001018 | |||
| 243 | Ga0207654_10001511 | |||
| 244 | Ga0207695_10002178 | |||
| 245 | Ga0207695_10033242 | |||
| 246 | Ga0207671_10040094 | |||
| 247 | Ga0207671_10067068 | |||
| 248 | Ga0207644_10010690 | |||
| 249 | Ga0207690_10386107 | |||
| 250 | Ga0207706_10000126 | |||
| 251 | Ga0207706_10241910 | |||
| 252 | Ga0207704_10000209 | |||
| 253 | Ga0207667_10038889 | |||
| 254 | Ga0207651_10082657 | |||
| 255 | Ga0207640_10014649 | |||
| 256 | Ga0207658_10192457 | |||
| 257 | Ga0207703_10420380 | |||
| 258 | Ga0207639_10041781 | |||
| 259 | Ga0207639_10841780 | |||
| 260 | Ga0207702_10083110 | |||
| 261 | Ga0207702_10164793 | |||
| 262 | Ga0207702_10207012 | |||
| 263 | Ga0207648_10000155 | |||
| 264 | Ga0207674_10121763 | |||
| 265 | Ga0207683_10012596 | |||
| 266 | Ga0207698_10009588 | |||
| 267 | Ga0307513_10097047 | |||
| 268 | Ga0307508_10000518 | |||
| 269 | Ga0307508_10248075 | |||
| 270 | Ga0307516_10331080 | |||
| 271 | Ga0373936_0049453 | |||
| 272 | Ga0400483_029993 | |||
| 273 | Ga0400483_210060 | |||
| 274 | Ga0400489_62215 | |||
| 275 | Ga0436361_0849165 | |||
| 276 | Ga0439466_0116639 | |||
| 277 | Ga0439431_0004687 | |||
| 278 | Ga0439442_001255 | |||
| 279 | Ga0439449_0010955 | |||
| 280 | Ga0439454_028640 | |||
| 281 | Ga0439457_002830 | |||
| 282 | Ga0439462_0002758 | |||
| 283 | Ga0450898_012309 | |||
| 284 | Ga0439434_0039469 | |||
| 285 | Ga0451577_0017788 | |||
| 286 | Ga0466969_0024874 | |||
| 287 | Ga0466972_0000026 | |||
| 288 | Ga0466972_0002405 | |||
| 289 | Ga0466966_0000038 | |||
| 290 | Ga0466970_0003659 | |||
| 291 | Ga0466960_0092717 | |||
| 292 | Ga0466959_0000421 | |||
| 293 | Ga0495627_000178 | |||
| 294 | Ga0495654_0000099 | |||
| 295 | Ga0495633_0000108 | |||
| 296 | Ga0495668_0001528 | |||
| 297 | Ga0495687_000762 | |||
| 298 | Ga0495686_0003382 | |||
| 299 | Ga0501043_0100249 | |||
| 300 | Ga0501047_0077107 | |||
| 301 | Ga0501219_000020 | |||
| 302 | Ga0501225_0103041 | |||
| 303 | Ga0501241_007980 | |||
| 304 | Ga0501035_0445386 | |||
| 305 | Ga0501044_0092923 | |||
| 306 | Ga0501284_00030 | |||
| 307 | nmdc:mga05p37_10942_c1 | |||
| 308 | nmdc:mga05p37_173318_c1 | |||
| 309 | Ga0500578_0000469 | |||
| 310 | Ga0500644_0012507 | |||
| 311 | Ga0500583_0000182 | |||
| 312 | Ga0500583_0001941 | |||
| 313 | Ga0500651_0190667 | |||
| 314 | Ga0500618_000756 | |||
| 315 | Ga0500658_0104544 | |||
| 316 | Ga0500604_0081409 | |||
| 317 | Ga0500616_0051497 | |||
| 318 | Ga0500622_0036043 | |||
| 319 | Ga0500637_0204527 | |||
| 320 | Ga0500584_122880 | |||
| 321 | Ga0466962_0083746 | |||
| 322 | 2511384975 | |||
| 323 | 2521557915 | |||
| 324 | 2553003038 | |||
| 325 | 2586209673 | |||
| 326 | 2587941907 | |||
| 327 | 2738725845 | |||
| 328 | 2765569035 | |||
| 329 | 2808984457 | |||
| 330 | 2819586623 | |||
| 331 | 2819614944 | |||
| 332 | 2883071784 | |||
| 333 | 2904441318 | |||
| 334 | 2904531742 | |||
| 335 | 2904588033 | |||
| 336 | 2904589807 | |||
| 337 | 2904602807 | |||
| 338 | 2911142089 | |||
| 339 | 2919046378 | |||
| 340 | 2919079689 | |||
| 341 | 2919399670 | |||
| 342 | 2923511150 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dxj-assembly1.cif.gz_B | crystal structure of trypanosome cruzi farnesyl diphosphate synthase in complex with [2-(n-propylamino)ethane-1,1-diyl]bisphosphonic acid and mg2+ | 0.3033 | 48 | 221 |
| 8woy-assembly1.cif.gz_A | cryo-em structure of sars-cov-2 omicron ba.4/5 rbd in complex with rabbit ace2 (local refinement) | 0.2909 | 27 | 180 |
| 4jkf-assembly2.cif.gz_B | open and closed forms of t1791p+r1865a human prp8 rnase h-like domain with bound mg ion | 0.2835 | 84 | 193 |
| 6u8t-assembly2.cif.gz_C | crystal structure of yopt domain of pasteurella multocida pfhb2-toxin | 0.2643 | 78 | 187 |
| 6zpu-assembly1.cif.gz_A | crystal structure of angiotensin-1 converting enzyme c-domain with inserted symmetry molecule c-terminus. | 0.2642 | 35 | 185 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGE5_1_282_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4601 | 3 | 197 | 1.20.1250.20 |
| af_P9WGE5_1_282_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.341 | 3 | 197 | 1.20.1250.20 |
| 5k3hH04 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.3244 | 78 | 193 | 1.20.140.10 |
| af_P9WJX1_16_194_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3237 | 2 | 146 | 1.20.1250.20 |
| af_Q2G199_259_457_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3187 | 2 | 150 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534AWJ3-F1-model_v4 | Adenosylcobinamide-GDP ribazoletransferase (EC 2.7.8.26) (Cobalamin synthase) (Cobalamin-5'-phosphate synthase) | 0.9831 | 2 | 163 |
GO:0005886
GO:0008818 GO:0009236 GO:0051073 |
| AF-A0A519PDC5-F1-model_v4 | deleted | 0.9785 | 3 | 156 |
|
| AF-A0A4Q1JIZ3-F1-model_v4 | Adenosylcobinamide-GDP ribazoletransferase (EC 2.7.8.26) (Cobalamin synthase) (Cobalamin-5'-phosphate synthase) | 0.9765 | 1 | 253 |
GO:0005886
GO:0008818 GO:0009236 GO:0051073 |
| AF-A0A432IKA1-F1-model_v4 | Adenosylcobinamide-GDP ribazoletransferase (EC 2.7.8.26) (Cobalamin synthase) (Cobalamin-5'-phosphate synthase) | 0.9739 | 1 | 250 |
GO:0005886
GO:0008818 GO:0009236 GO:0051073 |
| AF-A0A519UDW1-F1-model_v4 | Adenosylcobinamide-GDP ribazoletransferase (EC 2.7.8.26) (Cobalamin synthase) (Cobalamin-5'-phosphate synthase) | 0.9729 | 63 | 252 |
GO:0005886
GO:0008818 GO:0009236 GO:0051073 |