F259289

General Info

Members Datasets Scaffolds Average Seq Length
171 139 342 259

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0005377|Ga0466957_0005377_3674_4552
Length 292
Sequence LLEAKNKAARLQALQGSVEEHTMKKEIRIFFTAMMFLTRLPVPRFTDHSPEYLEKSPRYFPLIGYMVAATSALAFLIFNKYVSEDIAIAASIIAGILTTGAFHEDGFADVCDAFGGGWTKEKILTIMKDSRLGSYGVIGMIAILSTKFLLLRELPKFTPDMGHASMNIFYNYRYFLVTLIAAHAVSRLMPVLVMCFYEYAADPDGSKSKPVATRKPGMLELLVPIGTALVPFIFLHPVFLLAIAPVIYIAFSLARYFKKWIGGYTGDCLGAIQQVSELTFYLGTIIIWRYLI

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
29 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
45 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
71 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
72 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
73 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
74 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
77 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
78 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
79 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
80 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
81 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
82 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
83 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
84 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
93 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
94 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
101 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
102 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
108 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
109 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
110 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
111 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
112 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
113 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
114 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
115 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
116 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
117 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
118 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
119 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
120 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
121 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
122 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
123 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
124 2738541278 Niastella sp. CF465 Isolate Unclassified
125 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
126 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
127 2818991444 Filimonas endophytica 3197 Isolate Unclassified
128 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
129 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
130 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
131 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
132 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
133 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
134 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
135 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
136 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
137 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
138 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
139 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.72
Metatranscriptomes 0
Isolates 12.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.36
Nodule 0.58
Rhizoplane 0
Rhizosphere 76.61
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0005377 3300044842 Bacteria 7188
2 JGI24736J21556_1001238 3300001904 Bacteria 4690
3 JGI24744J21845_10002906 3300002077 Bacteria 3502
4 rootH1_10001457 3300003316 Bacteria 3827
5 rootH1_10062859 3300003316 Bacteria 4243
6 rootL2_10039916 3300003322 Bacteria 2163
7 rootL2_10126538 3300003322 Bacteria 2580
8 rootH1_10040060 3300003323 Bacteria 9733
9 JGI25160J50197_1000897 3300003354 Bacteria 15662
10 Ga0055538_1000002 3300003751 Bacteria 999437
11 Ga0065714_10002556 3300005288 Bacteria 21413
12 Ga0070676_10000197 3300005328 Bacteria 25353
13 Ga0068869_100064109 3300005334 Bacteria 2702
14 Ga0070660_100006514 3300005339 Bacteria 8099
15 Ga0070671_100005341 3300005355 Bacteria 10243
16 Ga0070659_100329570 3300005366 Bacteria 1277
17 Ga0070678_100005787 3300005456 Bacteria 7194
18 Ga0070662_100000068 3300005457 Bacteria 56624
19 Ga0070662_100216296 3300005457 Bacteria 1527
20 Ga0068867_100000938 3300005459 Bacteria 19833
21 Ga0068853_100059217 3300005539 Bacteria 3308
22 Ga0068853_100547060 3300005539 Bacteria 1096
23 Ga0068855_100002264 3300005563 Bacteria 23750
24 Ga0068855_100034572 3300005563 Bacteria 6026
25 Ga0068857_100079221 3300005577 Bacteria 2933
26 Ga0068854_100002464 3300005578 Bacteria 11457
27 Ga0068856_100003903 3300005614 Bacteria 14952
28 Ga0068856_100335208 3300005614 Bacteria 1530
29 Ga0068852_100000852 3300005616 Bacteria 20278
30 Ga0075366_10273846 3300006195 Bacteria 1031
31 Ga0097621_100000152 3300006237 Bacteria 42727
32 Ga0068871_100000229 3300006358 Bacteria 39643
33 Ga0068871_100039189 3300006358 Bacteria 3790
34 Ga0068865_100000505 3300006881 Bacteria 21848
35 Ga0079104_1013584 3300006946 Bacteria 2500
36 Ga0105250_10013838 3300009092 Bacteria 3323
37 Ga0105240_10023021 3300009093 Bacteria 8250
38 Ga0114129_10040922 3300009147 Bacteria 6531
39 Ga0105241_10001074 3300009174 Bacteria 20835
40 Ga0105241_10005347 3300009174 Bacteria 9486
41 Ga0105242_10008805 3300009176 Bacteria 7743
42 Ga0105237_10000356 3300009545 Bacteria 64629
43 Ga0105237_10014504 3300009545 Bacteria 8237
44 Ga0105238_10050370 3300009551 Bacteria 4193
45 Ga0105238_10074815 3300009551 Bacteria 3380
46 Ga0105239_10001183 3300010375 Bacteria 35762
47 Ga0105239_10018238 3300010375 Bacteria 7758
48 Ga0105239_10030727 3300010375 Bacteria 5908
49 Ga0105239_10106129 3300010375 Bacteria 3111
50 Ga0105246_10254095 3300011119 Bacteria 1397
51 Ga0105246_10317169 3300011119 Bacteria 1265
52 Ga0157371_10173736 3300013102 Bacteria 1540
53 Ga0157374_10000206 3300013296 Bacteria 54254
54 Ga0157374_10001305 3300013296 Bacteria 21219
55 Ga0157378_10018255 3300013297 Bacteria 6157
56 Ga0157378_10087013 3300013297 Bacteria 2833
57 Ga0157378_10356896 3300013297 Bacteria 1430
58 Ga0163162_10013498 3300013306 Bacteria 7974
59 Ga0157372_10093543 3300013307 Bacteria 3421
60 Ga0157372_10293379 3300013307 Bacteria 1891
61 Ga0157372_10379716 3300013307 Bacteria 1647
62 Ga0157375_10035473 3300013308 Bacteria 4761
63 Ga0157375_10042059 3300013308 Unclassified 4419
64 Ga0157375_10242414 3300013308 Bacteria 1962
65 Ga0182006_1012663 3300015261 Bacteria 3684
66 Ga0182007_10076965 3300015262 Bacteria 1094
67 Ga0163161_10454785 3300017792 Bacteria 1036
68 Ga0213872_10011089 3300021361 Bacteria 4272
69 Ga0207426_1000059 3300025302 Bacteria 363842
70 Ga0207647_10001659 3300025904 Bacteria 17144
71 Ga0207645_10001018 3300025907 Bacteria 23159
72 Ga0207654_10001511 3300025911 Bacteria 12268
73 Ga0207695_10002178 3300025913 Bacteria 29621
74 Ga0207695_10033242 3300025913 Bacteria 5629
75 Ga0207671_10040094 3300025914 Bacteria 3467
76 Ga0207671_10067068 3300025914 Bacteria 2672
77 Ga0207644_10010690 3300025931 Bacteria 6052
78 Ga0207690_10386107 3300025932 Bacteria 1114
79 Ga0207706_10000126 3300025933 Bacteria 82630
80 Ga0207706_10241910 3300025933 Bacteria 1578
81 Ga0207704_10000209 3300025938 Bacteria 29657
82 Ga0207667_10038889 3300025949 Bacteria 5074
83 Ga0207651_10082657 3300025960 Bacteria 2319
84 Ga0207640_10014649 3300025981 Bacteria 4517
85 Ga0207658_10192457 3300025986 Bacteria 1697
86 Ga0207703_10420380 3300026035 Bacteria 1244
87 Ga0207639_10041781 3300026041 Bacteria 3433
88 Ga0207639_10841780 3300026041 Bacteria 856
89 Ga0207702_10083110 3300026078 Bacteria 2785
90 Ga0207702_10164793 3300026078 Bacteria 2027
91 Ga0207702_10207012 3300026078 Bacteria 1822
92 Ga0207648_10000155 3300026089 Bacteria 69524
93 Ga0207674_10121763 3300026116 Bacteria 2576
94 Ga0207683_10012596 3300026121 Bacteria 7213
95 Ga0207698_10009588 3300026142 Bacteria 6183
96 Ga0307513_10097047 3300031456 Bacteria 2983
97 Ga0307508_10000518 3300031616 Bacteria 46205
98 Ga0307508_10248075 3300031616 Bacteria 1377
99 Ga0307516_10331080 3300031730 Bacteria 1192
100 Ga0373936_0049453 3300035113 Bacteria 1698
101 Ga0400483_029993 3300039062 Bacteria 14194
102 Ga0400483_210060 3300039062 Bacteria 6914
103 Ga0400489_62215 3300039093 Bacteria 5690
104 Ga0436361_0849165 3300039447 Bacteria 5333
105 Ga0439466_0116639 3300041411 Bacteria 826
106 Ga0439431_0004687 3300041997 Bacteria 3008
107 Ga0439442_001255 3300042002 Bacteria 5041
108 Ga0439449_0010955 3300042007 Bacteria 3422
109 Ga0439454_028640 3300042011 Bacteria 862
110 Ga0439457_002830 3300042014 Bacteria 4845
111 Ga0439462_0002758 3300042015 Bacteria 4125
112 Ga0450898_012309 3300042134 Bacteria 1412
113 Ga0439434_0039469 3300042435 Bacteria 1449
114 Ga0451577_0017788 3300042876 Bacteria 6559
115 Ga0466969_0024874 3300044656 Bacteria 3079
116 Ga0466972_0000026 3300044658 Bacteria 184739
117 Ga0466972_0002405 3300044658 Bacteria 9228
118 Ga0466966_0000038 3300044684 Bacteria 97255
119 Ga0466970_0003659 3300044765 Bacteria 7503
120 Ga0466960_0092717 3300044901 Bacteria 1542
121 Ga0466959_0000421 3300045049 Bacteria 24705
122 Ga0495627_000178 3300046453 Bacteria 72186
123 Ga0495654_0000099 3300046530 Bacteria 98758
124 Ga0495633_0000108 3300046558 Bacteria 111235
125 Ga0495668_0001528 3300046616 Bacteria 21968
126 Ga0495687_000762 3300047443 Bacteria 34827
127 Ga0495686_0003382 3300047472 Bacteria 13888
128 Ga0501043_0100249 3300049579 Bacteria 2277
129 Ga0501047_0077107 3300049581 Bacteria 3207
130 Ga0501219_000020 3300049703 Bacteria 25032
131 Ga0501225_0103041 3300049705 Bacteria 835
132 Ga0501241_007980 3300049758 Bacteria 1938
133 Ga0501035_0445386 3300049822 Bacteria 1072
134 Ga0501044_0092923 3300049823 Bacteria 3042
135 Ga0501284_00030 3300050005 Bacteria 71858
136 nmdc:mga05p37_10942_c1 3300050507 Bacteria 10772
137 nmdc:mga05p37_173318_c1 3300050507 Bacteria 2630
138 Ga0500578_0000469 3300053086 Bacteria 49263
139 Ga0500644_0012507 3300053088 Bacteria 2349
140 Ga0500583_0000182 3300053092 Bacteria 25516
141 Ga0500583_0001941 3300053092 Bacteria 6072
142 Ga0500651_0190667 3300053093 Bacteria 1214
143 Ga0500618_000756 3300053125 Bacteria 18284
144 Ga0500658_0104544 3300053134 Bacteria 1240
145 Ga0500604_0081409 3300053151 Bacteria 1046
146 Ga0500616_0051497 3300053153 Bacteria 2169
147 Ga0500622_0036043 3300053156 Bacteria 2587
148 Ga0500637_0204527 3300053178 Bacteria 1123
149 Ga0500584_122880 3300053726 Bacteria 1025
150 Ga0466962_0083746 3300061719 Bacteria 1526
151 2511384975 2511231026 Bacteria 5225445
152 2521557915 2521172590 Bacteria 5047645
153 2553003038 2551306416 Bacteria 6152985
154 2586209673 2585427687 Bacteria 5544917
155 2587941907 2585428115 Bacteria 4420269
156 2738725845 2738541278 Bacteria 9755573
157 2765569035 2765235838 Bacteria 5445269
158 2808984457 2808606386 Bacteria 4471946
159 2819586623 2818991444 Bacteria 6968812
160 2819614944 2818991449 Bacteria 5518009
161 2883071784 2883068021 Bacteria 6192739
162 2904441318 2904439833 Bacteria 5931679
163 2904531742 2904530477 Bacteria 5876334
164 2904588033 2904584206 Bacteria 6028872
165 2904589807 2904589729 Bacteria 6113573
166 2904602807 2904601388 Bacteria 5884906
167 2911142089 2911138879 Bacteria 5811561
168 2919046378 2919046199 Bacteria 5567169
169 2919079689 2919079590 Bacteria 5946433
170 2919399670 2919399522 Bacteria 5164947
171 2923511150 2923510766 Bacteria 5926163
172 Ga0466957_0005377
173 JGI24736J21556_1001238
174 JGI24744J21845_10002906
175 rootH1_10001457
176 rootH1_10062859
177 rootL2_10039916
178 rootL2_10126538
179 rootH1_10040060
180 JGI25160J50197_1000897
181 Ga0055538_1000002
182 Ga0065714_10002556
183 Ga0070676_10000197
184 Ga0068869_100064109
185 Ga0070660_100006514
186 Ga0070671_100005341
187 Ga0070659_100329570
188 Ga0070678_100005787
189 Ga0070662_100000068
190 Ga0070662_100216296
191 Ga0068867_100000938
192 Ga0068853_100059217
193 Ga0068853_100547060
194 Ga0068855_100002264
195 Ga0068855_100034572
196 Ga0068857_100079221
197 Ga0068854_100002464
198 Ga0068856_100003903
199 Ga0068856_100335208
200 Ga0068852_100000852
201 Ga0075366_10273846
202 Ga0097621_100000152
203 Ga0068871_100000229
204 Ga0068871_100039189
205 Ga0068865_100000505
206 Ga0079104_1013584
207 Ga0105250_10013838
208 Ga0105240_10023021
209 Ga0114129_10040922
210 Ga0105241_10001074
211 Ga0105241_10005347
212 Ga0105242_10008805
213 Ga0105237_10000356
214 Ga0105237_10014504
215 Ga0105238_10050370
216 Ga0105238_10074815
217 Ga0105239_10001183
218 Ga0105239_10018238
219 Ga0105239_10030727
220 Ga0105239_10106129
221 Ga0105246_10254095
222 Ga0105246_10317169
223 Ga0157371_10173736
224 Ga0157374_10000206
225 Ga0157374_10001305
226 Ga0157378_10018255
227 Ga0157378_10087013
228 Ga0157378_10356896
229 Ga0163162_10013498
230 Ga0157372_10093543
231 Ga0157372_10293379
232 Ga0157372_10379716
233 Ga0157375_10035473
234 Ga0157375_10042059
235 Ga0157375_10242414
236 Ga0182006_1012663
237 Ga0182007_10076965
238 Ga0163161_10454785
239 Ga0213872_10011089
240 Ga0207426_1000059
241 Ga0207647_10001659
242 Ga0207645_10001018
243 Ga0207654_10001511
244 Ga0207695_10002178
245 Ga0207695_10033242
246 Ga0207671_10040094
247 Ga0207671_10067068
248 Ga0207644_10010690
249 Ga0207690_10386107
250 Ga0207706_10000126
251 Ga0207706_10241910
252 Ga0207704_10000209
253 Ga0207667_10038889
254 Ga0207651_10082657
255 Ga0207640_10014649
256 Ga0207658_10192457
257 Ga0207703_10420380
258 Ga0207639_10041781
259 Ga0207639_10841780
260 Ga0207702_10083110
261 Ga0207702_10164793
262 Ga0207702_10207012
263 Ga0207648_10000155
264 Ga0207674_10121763
265 Ga0207683_10012596
266 Ga0207698_10009588
267 Ga0307513_10097047
268 Ga0307508_10000518
269 Ga0307508_10248075
270 Ga0307516_10331080
271 Ga0373936_0049453
272 Ga0400483_029993
273 Ga0400483_210060
274 Ga0400489_62215
275 Ga0436361_0849165
276 Ga0439466_0116639
277 Ga0439431_0004687
278 Ga0439442_001255
279 Ga0439449_0010955
280 Ga0439454_028640
281 Ga0439457_002830
282 Ga0439462_0002758
283 Ga0450898_012309
284 Ga0439434_0039469
285 Ga0451577_0017788
286 Ga0466969_0024874
287 Ga0466972_0000026
288 Ga0466972_0002405
289 Ga0466966_0000038
290 Ga0466970_0003659
291 Ga0466960_0092717
292 Ga0466959_0000421
293 Ga0495627_000178
294 Ga0495654_0000099
295 Ga0495633_0000108
296 Ga0495668_0001528
297 Ga0495687_000762
298 Ga0495686_0003382
299 Ga0501043_0100249
300 Ga0501047_0077107
301 Ga0501219_000020
302 Ga0501225_0103041
303 Ga0501241_007980
304 Ga0501035_0445386
305 Ga0501044_0092923
306 Ga0501284_00030
307 nmdc:mga05p37_10942_c1
308 nmdc:mga05p37_173318_c1
309 Ga0500578_0000469
310 Ga0500644_0012507
311 Ga0500583_0000182
312 Ga0500583_0001941
313 Ga0500651_0190667
314 Ga0500618_000756
315 Ga0500658_0104544
316 Ga0500604_0081409
317 Ga0500616_0051497
318 Ga0500622_0036043
319 Ga0500637_0204527
320 Ga0500584_122880
321 Ga0466962_0083746
322 2511384975
323 2521557915
324 2553003038
325 2586209673
326 2587941907
327 2738725845
328 2765569035
329 2808984457
330 2819586623
331 2819614944
332 2883071784
333 2904441318
334 2904531742
335 2904588033
336 2904589807
337 2904602807
338 2911142089
339 2919046378
340 2919079689
341 2919399670
342 2923511150

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02654

CobS

Cobalamin-5-phosphate synthase

33

282

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dxj-assembly1.cif.gz_B crystal structure of trypanosome cruzi farnesyl diphosphate synthase in complex with [2-(n-propylamino)ethane-1,1-diyl]bisphosphonic acid and mg2+ 0.3033 48 221
8woy-assembly1.cif.gz_A cryo-em structure of sars-cov-2 omicron ba.4/5 rbd in complex with rabbit ace2 (local refinement) 0.2909 27 180
4jkf-assembly2.cif.gz_B open and closed forms of t1791p+r1865a human prp8 rnase h-like domain with bound mg ion 0.2835 84 193
6u8t-assembly2.cif.gz_C crystal structure of yopt domain of pasteurella multocida pfhb2-toxin 0.2643 78 187
6zpu-assembly1.cif.gz_A crystal structure of angiotensin-1 converting enzyme c-domain with inserted symmetry molecule c-terminus. 0.2642 35 185
ID Description Score Start End Superfamily
af_P9WGE5_1_282_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4601 3 197 1.20.1250.20
af_P9WGE5_1_282_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.341 3 197 1.20.1250.20
5k3hH04 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.3244 78 193 1.20.140.10
af_P9WJX1_16_194_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3237 2 146 1.20.1250.20
af_Q2G199_259_457_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3187 2 150 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A534AWJ3-F1-model_v4 Adenosylcobinamide-GDP ribazoletransferase (EC 2.7.8.26) (Cobalamin synthase) (Cobalamin-5'-phosphate synthase) 0.9831 2 163 GO:0005886
GO:0008818
GO:0009236
GO:0051073
AF-A0A519PDC5-F1-model_v4 deleted 0.9785 3 156
AF-A0A4Q1JIZ3-F1-model_v4 Adenosylcobinamide-GDP ribazoletransferase (EC 2.7.8.26) (Cobalamin synthase) (Cobalamin-5'-phosphate synthase) 0.9765 1 253 GO:0005886
GO:0008818
GO:0009236
GO:0051073
AF-A0A432IKA1-F1-model_v4 Adenosylcobinamide-GDP ribazoletransferase (EC 2.7.8.26) (Cobalamin synthase) (Cobalamin-5'-phosphate synthase) 0.9739 1 250 GO:0005886
GO:0008818
GO:0009236
GO:0051073
AF-A0A519UDW1-F1-model_v4 Adenosylcobinamide-GDP ribazoletransferase (EC 2.7.8.26) (Cobalamin synthase) (Cobalamin-5'-phosphate synthase) 0.9729 63 252 GO:0005886
GO:0008818
GO:0009236
GO:0051073

Map