F258462

General Info

Members Datasets Scaffolds Average Seq Length
171 115 155 303

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10009451|Ga0070717_100094515
Length 338
Sequence MVRSMNEAALNTTRPAAVGLRPSALCSPAMAELDLDDLAVFVRVIEHGGFASAARQLGEPTSTVSRAIARLEARSGVRLLHRTTRSVRPTSEGHELYASIAPAVSTLRSAAQALEPSTRKPKGRVRVTAPNDLCASFLPEVIVAFLERYPLVNLDFTVTNQHSNLVGEGFDVALRAAARLSDSTLVARKLGELELRLYASPKYAKKYGLPATPDELHQHKCIVFRAEELVRTWALAGTQGDANLQIRGRIGGDDFSFVRAIVGAGGGIGILPHINSAADEASGRLVRVLPDYHLRGATLYLLYPSSRNLPTRVTAFRDFVIEAFDAWSARRDRGPSVG

Samples

Sample ID Description Type Environment
1 2738541280 Massilia sp. GV090 Isolate Unclassified
2 2738541297 Duganella sp. GV083 Isolate Unclassified
3 2738541357 Duganella sp. GV053 Isolate Unclassified
4 2738543003 Duganella sp. GV066 Isolate Unclassified
5 2738543026 Duganella sp. GV089 Isolate Unclassified
6 2738543029 Duganella sp. GV039 Isolate Unclassified
7 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
8 2821131069 Duganella sp. 1224 Isolate Unclassified
9 2842711865 Duganella sp. R-73148 Isolate Unclassified
10 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
11 2857558681 Duganella sp. R-74565 Isolate Unclassified
12 2857564685 Duganella sp. R-74599 Isolate Unclassified
13 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
14 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
15 2904424332 Duganella sp. 1411 Isolate Rhizosphere
16 2941479691
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
38 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
47 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
48 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
49 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
50 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
51 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
52 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
53 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
54 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
55 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
58 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
59 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
60 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
61 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
62 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
63 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
64 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
65 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
66 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
67 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
68 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
69 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
70 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
71 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
72 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
73 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
74 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
75 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
76 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
77 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
78 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
79 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
82 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
83 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
84 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
85 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
86 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
87 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
88 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
89 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
90 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
91 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
92 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
93 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
94 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
97 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
98 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
101 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
102 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
103 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
109 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
110 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
111 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
112 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
113 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
114 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
115 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.64
Metatranscriptomes 0
Isolates 9.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.02
Nodule 0
Rhizoplane 1.17
Rhizosphere 72.51
Stem 0
Stem Tuber 0
Unclassified 19.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10026437 3300003215 Bacteria 2053
2 rootH2_10276245 3300003320 Unclassified 1994
3 rootH1_10041030 3300003323 Bacteria 7982
4 rootH1_10262070 3300003323 Bacteria 2974
5 Ga0070658_10075321 3300005327 Bacteria 2768
6 Ga0070680_100076861 3300005336 Bacteria 2749
7 Ga0070682_100011264 3300005337 Bacteria 5104
8 Ga0070714_100149709 3300005435 Bacteria 2102
9 Ga0068867_100105958 3300005459 Bacteria 2153
10 Ga0068855_100008812 3300005563 Bacteria 12194
11 Ga0068856_100218035 3300005614 Bacteria 1923
12 Ga0068862_100012604 3300005844 Bacteria 6998
13 Ga0070717_10009451 3300006028 Bacteria 7328
14 Ga0070717_10134439 3300006028 Bacteria 2128
15 Ga0075366_10008963 3300006195 Bacteria 5578
16 Ga0105244_10002319 3300009036 Bacteria 14472
17 Ga0105244_10003935 3300009036 Bacteria 10426
18 Ga0105240_10004485 3300009093 Bacteria 21237
19 Ga0105243_10073415 3300009148 Bacteria 2772
20 Ga0105238_10199485 3300009551 Bacteria 1976
21 Ga0213872_10018696 3300021361 Bacteria 3194
22 Ga0209025_1013688 3300025294 Bacteria 5071
23 Ga0209564_1000009 3300025295 Bacteria 950196
24 Ga0209758_1000689 3300025297 Bacteria 50075
25 Ga0207655_1002357 3300025728 Bacteria 15426
26 Ga0207655_1004706 3300025728 Bacteria 9549
27 Ga0207695_10023115 3300025913 Bacteria 7035
28 Ga0207660_10034023 3300025917 Bacteria 3529
29 Ga0207694_10269567 3300025924 Bacteria 1396
30 Ga0207709_10034208 3300025935 Bacteria 2993
31 Ga0207702_10085950 3300026078 Bacteria 2742
32 Ga0209371_1004336 3300027312 Bacteria 6245
33 Ga0268265_10033096 3300028380 Bacteria 3755
34 Ga0268256_1006078 3300030500 Bacteria 4567
35 Ga0316181_1007093 3300030744 Bacteria 5128
36 Ga0316181_1182478 3300030744 Bacteria 5461
37 Ga0307513_10317033 3300031456 Bacteria 1319
38 Ga0307509_10000330 3300031507 Bacteria 78146
39 Ga0307516_10001021 3300031730 Bacteria 38830
40 Ga0307412_10000129 3300031911 Bacteria 55318
41 Ga0307412_10323674 3300031911 Bacteria 1228
42 Ga0307507_10136023 3300033179 Bacteria 1903
43 Ga0373961_0000008 3300035241 Bacteria 139095
44 Ga0395905_0000063 3300037471 Bacteria 187830
45 Ga0436361_0453993 3300039447 Bacteria 3723
46 Ga0451577_0447319 3300042876 Bacteria 1173
47 Ga0495617_000025 3300046452 Bacteria 164547
48 Ga0495617_000330 3300046452 Bacteria 26567
49 Ga0495590_0000014 3300046457 Bacteria 258314
50 Ga0495638_0000064 3300046460 Bacteria 180807
51 Ga0495638_0010959 3300046460 Bacteria 6270
52 Ga0495638_0043815 3300046460 Bacteria 2821
53 Ga0495638_0148275 3300046460 Bacteria 1363
54 Ga0495638_0222515 3300046460 Bacteria 1054
55 Ga0495653_0000016 3300046463 Bacteria 200976
56 Ga0495650_0000141 3300046471 Bacteria 168676
57 Ga0495650_0000255 3300046471 Bacteria 103396
58 Ga0495650_0000992 3300046471 Bacteria 32292
59 Ga0495650_0001991 3300046471 Bacteria 17939
60 Ga0495639_0010811 3300046475 Bacteria 3930
61 Ga0495584_0001774 3300046491 Bacteria 12561
62 Ga0495585_0000798 3300046492 Bacteria 27541
63 Ga0495607_0009737 3300046501 Bacteria 6487
64 Ga0495583_0000044 3300046506 Bacteria 226264
65 Ga0495606_0000037 3300046507 Bacteria 231282
66 Ga0495606_0000051 3300046507 Bacteria 201659
67 Ga0495606_0000319 3300046507 Bacteria 82626
68 Ga0495606_0000480 3300046507 Bacteria 65473
69 Ga0495606_0002074 3300046507 Bacteria 24489
70 Ga0495610_0000027 3300046512 Bacteria 275273
71 Ga0495610_0003802 3300046512 Bacteria 11507
72 Ga0495610_0006322 3300046512 Bacteria 8195
73 Ga0495610_0026022 3300046512 Bacteria 3130
74 Ga0495610_0039313 3300046512 Bacteria 2393
75 Ga0495637_0000193 3300046520 Bacteria 47867
76 Ga0495637_0001031 3300046520 Bacteria 17468
77 Ga0495643_0000184 3300046522 Bacteria 100035
78 Ga0495643_0000365 3300046522 Bacteria 61592
79 Ga0495648_0000006 3300046524 Bacteria 361208
80 Ga0495648_0003068 3300046524 Bacteria 14916
81 Ga0495648_0003461 3300046524 Bacteria 13885
82 Ga0495648_0008970 3300046524 Bacteria 7812
83 Ga0495648_0062907 3300046524 Bacteria 2195
84 Ga0495642_0000388 3300046528 Bacteria 23790
85 Ga0495654_0000022 3300046530 Bacteria 260104
86 Ga0495654_0003064 3300046530 Bacteria 10406
87 Ga0495609_0007817 3300046538 Bacteria 5294
88 Ga0495597_0000120 3300046542 Bacteria 70808
89 Ga0495597_0001113 3300046542 Bacteria 20346
90 Ga0495622_0000013 3300046557 Bacteria 186778
91 Ga0495633_0000430 3300046558 Bacteria 43655
92 Ga0495633_0002546 3300046558 Bacteria 12792
93 Ga0495633_0009472 3300046558 Bacteria 5375
94 Ga0495656_0109202 3300046615 Bacteria 1291
95 Ga0495668_0000232 3300046616 Bacteria 79391
96 Ga0495668_0000506 3300046616 Bacteria 48675
97 Ga0495668_0000599 3300046616 Bacteria 43861
98 Ga0495625_0000394 3300046660 Bacteria 66655
99 Ga0495625_0000455 3300046660 Bacteria 61315
100 Ga0495625_0005419 3300046660 Bacteria 11647
101 Ga0495659_0000079 3300046664 Bacteria 41571
102 Ga0495661_0032374 3300046665 Bacteria 3305
103 Ga0495671_0000064 3300046692 Bacteria 106374
104 Ga0495671_0000535 3300046692 Bacteria 28720
105 Ga0495671_0011593 3300046692 Bacteria 4844
106 Ga0495671_0018175 3300046692 Bacteria 3733
107 Ga0495649_0010643 3300046694 Bacteria 5417
108 Ga0495649_0011313 3300046694 Bacteria 5239
109 Ga0495649_0022342 3300046694 Bacteria 3540
110 Ga0495649_0092863 3300046694 Bacteria 1607
111 Ga0495660_0002858 3300046810 Bacteria 10852
112 Ga0495660_0005093 3300046810 Bacteria 7895
113 Ga0495672_0000075 3300047320 Bacteria 175957
114 Ga0495672_0000262 3300047320 Bacteria 73028
115 Ga0495683_0007571 3300047323 Bacteria 5856
116 Ga0495687_002482 3300047443 Bacteria 14712
117 Ga0495677_0017817 3300047445 Bacteria 2574
118 Ga0495677_0018104 3300047445 Bacteria 2553
119 Ga0495679_017589 3300047446 Bacteria 2556
120 Ga0495673_0000008 3300047469 Bacteria 752462
121 Ga0495673_0000009 3300047469 Bacteria 731993
122 Ga0495673_0000012 3300047469 Bacteria 656908
123 Ga0495673_0014423 3300047469 Bacteria 4109
124 Ga0495686_0006458 3300047472 Bacteria 8971
125 Ga0495686_0024133 3300047472 Bacteria 3999
126 Ga0495686_0035485 3300047472 Bacteria 3205
127 Ga0495615_0002196 3300048090 Bacteria 3086
128 Ga0496103_0002358 3300048906 Bacteria 11915
129 Ga0496115_0103454 3300048918 Bacteria 2336
130 Ga0496117_0020912 3300048920 Bacteria 5321
131 Ga0496118_0033344 3300048921 Bacteria 4226
132 Ga0496119_0067412 3300048922 Bacteria 2110
133 Ga0496121_0000137 3300048924 Bacteria 164043
134 Ga0496121_0018847 3300048924 Bacteria 6927
135 Ga0496122_0027829 3300048925 Bacteria 4820
136 Ga0496122_0048168 3300048925 Bacteria 3281
137 Ga0496123_0017355 3300048926 Bacteria 5795
138 Ga0496123_0021745 3300048926 Bacteria 4973
139 Ga0496124_0138183 3300048927 Bacteria 1926
140 Ga0496125_0000023 3300048928 Bacteria 449042
141 Ga0496125_0036987 3300048928 Bacteria 4251
142 Ga0496126_0096401 3300048929 Bacteria 2593
143 Ga0495678_000114 3300049459 Bacteria 96823
144 Ga0495678_007856 3300049459 Bacteria 5479
145 Ga0501047_0039604 3300049581 Bacteria 4558
146 Ga0501080_0358596 3300049742 Bacteria 1316
147 Ga0501269_000064 3300049766 Bacteria 33135
148 Ga0501269_000301 3300049766 Bacteria 13446
149 nmdc:mga0k408_30710_c1 3300050493 Bacteria 3065
150 Ga0500635_0006608 3300053080 Bacteria 3103
151 Ga0500618_000168 3300053125 Bacteria 54749
152 Ga0500568_0008965 3300053139 Bacteria 4782
153 Ga0500586_000726 3300053145 Bacteria 6761
154 Ga0500630_073264 3300053159 Bacteria 1616
155 Ga0500639_153534 3300053163 Unclassified 1058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046512 Ga0495610_0003802 Ga0495610_0003802_10410_11363 282
2 3300049766 Ga0501269_000301 Ga0501269_000301_5227_6258 282
3 3300009036 Ga0105244_10003935 Ga0105244_1000393511 283
4 3300025728 Ga0207655_1002357 Ga0207655_100235716 283
5 3300030744 Ga0316181_1182478 Ga0316181_11824783 283
6 3300048918 Ga0496115_0103454 Ga0496115_0103454_244_1173 285
7 3300031730 Ga0307516_10001021 Ga0307516_1000102110 286
8 3300047472 Ga0495686_0035485 Ga0495686_0035485_2193_3062 288
9 3300053139 Ga0500568_0008965 Ga0500568_0008965_1636_2505 288
10 3300005327 Ga0070658_10075321 Ga0070658_100753213 289
11 3300005336 Ga0070680_100076861 Ga0070680_1000768612 289
12 3300005435 Ga0070714_100149709 Ga0070714_1001497092 289
13 3300005563 Ga0068855_100008812 Ga0068855_1000088125 289
14 3300005614 Ga0068856_100218035 Ga0068856_1002180352 289
15 3300009093 Ga0105240_10004485 Ga0105240_1000448511 289
16 3300009551 Ga0105238_10199485 Ga0105238_101994853 289
17 3300025913 Ga0207695_10023115 Ga0207695_100231153 289
18 3300025917 Ga0207660_10034023 Ga0207660_100340231 289
19 3300025924 Ga0207694_10269567 Ga0207694_102695671 289
20 3300031911 Ga0307412_10323674 Ga0307412_103236742 290
21 3300049742 Ga0501080_0358596 Ga0501080_0358596_160_1035 290
22 iso_pu_bacteria 2857537821 2857539917 290
23 iso_pu_bacteria 2889790730 2889792085 290
24 iso_pu_bacteria 2889914905 2889919243 290
25 iso_pu_bacteria 2941479691 2941479885 290
26 iso_pu_bacteria 2738543031 2739351280 291
27 3300003320 rootH2_10276245 rootH2_102762451 293
28 3300003323 rootH1_10041030 rootH1_100410305 293
29 3300003323 rootH1_10262070 rootH1_102620701 293
30 3300005337 Ga0070682_100011264 Ga0070682_1000112643 293
31 3300005459 Ga0068867_100105958 Ga0068867_1001059583 293
32 3300005844 Ga0068862_100012604 Ga0068862_1000126042 293
33 3300006028 Ga0070717_10009451 Ga0070717_100094515 293
34 3300006028 Ga0070717_10134439 Ga0070717_101344392 293
35 3300006195 Ga0075366_10008963 Ga0075366_100089633 293
36 3300009148 Ga0105243_10073415 Ga0105243_100734153 293
37 3300025935 Ga0207709_10034208 Ga0207709_100342083 293
38 3300026078 Ga0207702_10085950 Ga0207702_100859502 293
39 3300028380 Ga0268265_10033096 Ga0268265_100330964 293
40 3300031456 Ga0307513_10317033 Ga0307513_103170331 293
41 3300031507 Ga0307509_10000330 Ga0307509_1000033020 293
42 3300033179 Ga0307507_10136023 Ga0307507_101360232 293
43 3300035241 Ga0373961_0000008 Ga0373961_0000008_50979_51899 293
44 3300037471 Ga0395905_0000063 Ga0395905_0000063_43254_44195 293
45 3300042876 Ga0451577_0447319 Ga0451577_0447319_55_981 293
46 3300049581 Ga0501047_0039604 Ga0501047_0039604_832_1782 293
47 3300050493 nmdc:mga0k408_30710_c1 nmdc:mga0k408_30710_c1_1047_1982 293
48 3300053080 Ga0500635_0006608 Ga0500635_0006608_254_1171 293
49 3300053159 Ga0500630_073264 Ga0500630_073264_305_1264 293
50 3300053163 Ga0500639_153534 Ga0500639_153534_50_1009 293
51 3300027312 Ga0209371_1004336 Ga0209371_10043364 294
52 3300030500 Ga0268256_1006078 Ga0268256_10060784 294
53 3300031911 Ga0307412_10000129 Ga0307412_100001299 294
54 3300048920 Ga0496117_0020912 Ga0496117_0020912_2919_3836 294
55 3300048921 Ga0496118_0033344 Ga0496118_0033344_1758_2675 294
56 3300048922 Ga0496119_0067412 Ga0496119_0067412_1075_1971 294
57 3300048924 Ga0496121_0000137 Ga0496121_0000137_91058_91954 294
58 3300048926 Ga0496123_0021745 Ga0496123_0021745_2577_3473 294
59 3300048927 Ga0496124_0138183 Ga0496124_0138183_613_1509 294
60 3300048928 Ga0496125_0000023 Ga0496125_0000023_385565_386461 294
61 3300048928 Ga0496125_0036987 Ga0496125_0036987_1044_1961 294
62 3300048929 Ga0496126_0096401 Ga0496126_0096401_233_1129 294
63 iso_pu_bacteria 2738541280 2738741799 294
64 iso_pu_bacteria 2738541297 2738826535 294
65 iso_pu_bacteria 2738541357 2739150332 294
66 iso_pu_bacteria 2738543003 2739192251 294
67 iso_pu_bacteria 2738543026 2739318728 294
68 iso_pu_bacteria 2738543029 2739336969 294
69 iso_pu_bacteria 2821131069 2821135251 294
70 iso_pu_bacteria 2842711865 2842718145 294
71 iso_pu_bacteria 2857558681 2857559084 294
72 iso_pu_bacteria 2857564685 2857567728 294
73 iso_pu_bacteria 2904424332 2904428017 294
74 3300046491 Ga0495584_0001774 Ga0495584_0001774_3854_4801 296
75 3300046524 Ga0495648_0062907 Ga0495648_0062907_927_1817 296
76 3300046694 Ga0495649_0011313 Ga0495649_0011313_104_997 296
77 3300003215 JGI25153J46596_10026437 JGI25153J46596_100264373 298
78 3300009036 Ga0105244_10002319 Ga0105244_1000231912 298
79 3300021361 Ga0213872_10018696 Ga0213872_100186962 298
80 3300025294 Ga0209025_1013688 Ga0209025_10136883 298
81 3300025295 Ga0209564_1000009 Ga0209564_1000009647 298
82 3300025297 Ga0209758_1000689 Ga0209758_100068913 298
83 3300025728 Ga0207655_1004706 Ga0207655_10047063 298
84 3300030744 Ga0316181_1007093 Ga0316181_10070931 298
85 3300039447 Ga0436361_0453993 Ga0436361_0453993_504_1409 298
86 3300046452 Ga0495617_000025 Ga0495617_000025_59202_60098 298
87 3300046452 Ga0495617_000330 Ga0495617_000330_9860_10756 298
88 3300046457 Ga0495590_0000014 Ga0495590_0000014_103316_104224 298
89 3300046460 Ga0495638_0000064 Ga0495638_0000064_26209_27117 298
90 3300046460 Ga0495638_0010959 Ga0495638_0010959_3193_4107 298
91 3300046460 Ga0495638_0043815 Ga0495638_0043815_1544_2440 298
92 3300046460 Ga0495638_0148275 Ga0495638_0148275_99_995 298
93 3300046460 Ga0495638_0222515 Ga0495638_0222515_70_966 298
94 3300046463 Ga0495653_0000016 Ga0495653_0000016_141878_142780 298
95 3300046471 Ga0495650_0000141 Ga0495650_0000141_157294_158190 298
96 3300046471 Ga0495650_0000255 Ga0495650_0000255_100545_101459 298
97 3300046471 Ga0495650_0000992 Ga0495650_0000992_22038_22946 298
98 3300046471 Ga0495650_0001991 Ga0495650_0001991_15541_16443 298
99 3300046475 Ga0495639_0010811 Ga0495639_0010811_22_930 298
100 3300046492 Ga0495585_0000798 Ga0495585_0000798_16495_17391 298
101 3300046501 Ga0495607_0009737 Ga0495607_0009737_1358_2266 298
102 3300046506 Ga0495583_0000044 Ga0495583_0000044_37828_38736 298
103 3300046507 Ga0495606_0000037 Ga0495606_0000037_2934_3833 298
104 3300046507 Ga0495606_0000051 Ga0495606_0000051_167208_168110 298
105 3300046507 Ga0495606_0000319 Ga0495606_0000319_44610_45506 298
106 3300046507 Ga0495606_0000480 Ga0495606_0000480_45747_46658 298
107 3300046507 Ga0495606_0002074 Ga0495606_0002074_23398_24306 298
108 3300046512 Ga0495610_0000027 Ga0495610_0000027_101002_101937 298
109 3300046512 Ga0495610_0006322 Ga0495610_0006322_4196_5092 298
110 3300046512 Ga0495610_0026022 Ga0495610_0026022_1267_2190 298
111 3300046512 Ga0495610_0039313 Ga0495610_0039313_1062_1967 298
112 3300046520 Ga0495637_0000193 Ga0495637_0000193_13145_14047 298
113 3300046520 Ga0495637_0001031 Ga0495637_0001031_6239_7135 298
114 3300046522 Ga0495643_0000184 Ga0495643_0000184_83294_84190 298
115 3300046522 Ga0495643_0000365 Ga0495643_0000365_33859_34767 298
116 3300046524 Ga0495648_0000006 Ga0495648_0000006_206683_207591 298
117 3300046524 Ga0495648_0003068 Ga0495648_0003068_3054_3989 298
118 3300046524 Ga0495648_0003461 Ga0495648_0003461_5106_6002 298
119 3300046524 Ga0495648_0008970 Ga0495648_0008970_2291_3187 298
120 3300046528 Ga0495642_0000388 Ga0495642_0000388_20459_21367 298
121 3300046530 Ga0495654_0000022 Ga0495654_0000022_194908_195810 298
122 3300046530 Ga0495654_0003064 Ga0495654_0003064_5761_6657 298
123 3300046538 Ga0495609_0007817 Ga0495609_0007817_1922_2830 298
124 3300046542 Ga0495597_0000120 Ga0495597_0000120_10623_11531 298
125 3300046542 Ga0495597_0001113 Ga0495597_0001113_15058_15999 298
126 3300046557 Ga0495622_0000013 Ga0495622_0000013_159712_160620 298
127 3300046558 Ga0495633_0000430 Ga0495633_0000430_32700_33650 298
128 3300046558 Ga0495633_0002546 Ga0495633_0002546_2042_2950 298
129 3300046558 Ga0495633_0009472 Ga0495633_0009472_288_1184 298
130 3300046615 Ga0495656_0109202 Ga0495656_0109202_156_1079 298
131 3300046616 Ga0495668_0000232 Ga0495668_0000232_31975_32871 298
132 3300046616 Ga0495668_0000506 Ga0495668_0000506_6844_7767 298
133 3300046616 Ga0495668_0000599 Ga0495668_0000599_35574_36482 298
134 3300046660 Ga0495625_0000394 Ga0495625_0000394_39875_40789 298
135 3300046660 Ga0495625_0000455 Ga0495625_0000455_42425_43333 298
136 3300046660 Ga0495625_0005419 Ga0495625_0005419_8992_9888 298
137 3300046664 Ga0495659_0000079 Ga0495659_0000079_25693_26634 298
138 3300046665 Ga0495661_0032374 Ga0495661_0032374_1015_1911 298
139 3300046692 Ga0495671_0000064 Ga0495671_0000064_46482_47417 298
140 3300046692 Ga0495671_0000535 Ga0495671_0000535_12370_13311 298
141 3300046692 Ga0495671_0011593 Ga0495671_0011593_1009_1905 298
142 3300046692 Ga0495671_0018175 Ga0495671_0018175_2169_3065 298
143 3300046694 Ga0495649_0010643 Ga0495649_0010643_783_1679 298
144 3300046694 Ga0495649_0022342 Ga0495649_0022342_1415_2374 298
145 3300046694 Ga0495649_0092863 Ga0495649_0092863_645_1568 298
146 3300046810 Ga0495660_0002858 Ga0495660_0002858_3972_4880 298
147 3300046810 Ga0495660_0005093 Ga0495660_0005093_3800_4696 298
148 3300047320 Ga0495672_0000075 Ga0495672_0000075_37056_37952 298
149 3300047320 Ga0495672_0000262 Ga0495672_0000262_15020_15961 298
150 3300047323 Ga0495683_0007571 Ga0495683_0007571_2558_3454 298
151 3300047443 Ga0495687_002482 Ga0495687_002482_10884_11792 298
152 3300047445 Ga0495677_0017817 Ga0495677_0017817_781_1689 298
153 3300047445 Ga0495677_0018104 Ga0495677_0018104_1079_1975 298
154 3300047446 Ga0495679_017589 Ga0495679_017589_1491_2387 298
155 3300047469 Ga0495673_0000008 Ga0495673_0000008_196663_197559 298
156 3300047469 Ga0495673_0000009 Ga0495673_0000009_160539_161435 298
157 3300047469 Ga0495673_0000012 Ga0495673_0000012_64584_65480 298
158 3300047469 Ga0495673_0014423 Ga0495673_0014423_2213_3109 298
159 3300047472 Ga0495686_0006458 Ga0495686_0006458_1707_2630 298
160 3300047472 Ga0495686_0024133 Ga0495686_0024133_208_1104 298
161 3300048090 Ga0495615_0002196 Ga0495615_0002196_595_1503 298
162 3300048906 Ga0496103_0002358 Ga0496103_0002358_8519_9421 298
163 3300048924 Ga0496121_0018847 Ga0496121_0018847_3568_4512 298
164 3300048925 Ga0496122_0027829 Ga0496122_0027829_2861_3763 298
165 3300048925 Ga0496122_0048168 Ga0496122_0048168_1696_2592 298
166 3300048926 Ga0496123_0017355 Ga0496123_0017355_1636_2538 298
167 3300049459 Ga0495678_000114 Ga0495678_000114_37015_37911 298
168 3300049459 Ga0495678_007856 Ga0495678_007856_2266_3174 298
169 3300049766 Ga0501269_000064 Ga0501269_000064_5176_6147 298
170 3300053125 Ga0500618_000168 Ga0500618_000168_20501_21403 298
171 3300053145 Ga0500586_000726 Ga0500586_000726_3614_4510 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

35

94

0.98

PF03466

LysR_substrate

LysR substrate binding domain

118

325

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9632 4 83
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9609 4 83
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9535 4 80
7trv-assembly1.cif.gz_B crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9505 4 83
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9462 4 83
ID Description Score Start End Superfamily
af_P30864_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9904 6 83 1.10.10.10
af_P52696_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9839 4 79 1.10.10.10
af_P77744_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9798 4 84 1.10.10.10
af_P77171_5_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9757 4 80 1.10.10.10
af_Q57083_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9739 6 79 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y4T7C7-F1-model_v4 LysR family transcriptional regulator 0.9211 109 295 GO:0003700
GO:0006351
GO:0043565
AF-H1S4I0-F1-model_v4 HTH-type transcriptional activator TtdR 0.9072 47 297
AF-A0A447T6W0-F1-model_v4 D-malate degradation protein R 0.9056 87 297 GO:0003700
GO:0006351
GO:0043565
AF-J2H940-F1-model_v4 Transcriptional regulator 0.8934 155 295
AF-A0A2G2NJW5-F1-model_v4 LysR family transcriptional regulator 0.8792 1 298 GO:0003700

Feature Viewer

pLDDT pTM Quality
89.51 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map