F257982

General Info

Members Datasets Scaffolds Average Seq Length
171 89 342 129

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10760564|Ga0070658_107605642
Length 144
Sequence MPKFRGTCFAIRTSVIDPIFQSDNYQMARKLLDAAVLRQEAIASNIANAETPGYHRLDIAPDFAQQLKSRMAAGDFAATADQIKPHLAEDLTARSMRPDGNTVEIERELLAMNNNAVQHEYLAELISGNLKQLKMAITGRSSIS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
9 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
10 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
11 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
12 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
13 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
14 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
15 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
23 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
24 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
25 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
26 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
27 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
28 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
29 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
30 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
31 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
32 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
33 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
34 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
35 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
36 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
39 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
40 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
43 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
44 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
45 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
46 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
47 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
48 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
49 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
50 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
53 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
54 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
55 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
61 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
62 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
63 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
64 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
65 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
66 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
80 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
81 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
82 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
83 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
86 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
87 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
88 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
89 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 0
Rhizosphere 94.15
Stem 0
Stem Tuber 0
Unclassified 19.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10760564 3300005327 Bacteria 841
2 rootH2_10003644 3300003320 Bacteria 11724
3 rootL2_10147921 3300003322 Bacteria 1048
4 rootL2_10212667 3300003322 Bacteria 7094
5 rootL2_10307212 3300003322 Bacteria 2531
6 Ga0070658_10512891 3300005327 Bacteria 1036
7 Ga0070683_100366883 3300005329 Unclassified 1371
8 Ga0070713_100820841 3300005436 Bacteria 892
9 Ga0070679_100033990 3300005530 Bacteria 5051
10 Ga0068856_102078517 3300005614 Bacteria 578
11 Ga0068859_102462285 3300005617 Unclassified 573
12 Ga0068864_101662483 3300005618 Bacteria 643
13 Ga0097620_102461001 3300006931 Unclassified 573
14 Ga0105237_11752090 3300009545 Bacteria 629
15 Ga0157370_11540638 3300013104 Unclassified 597
16 Ga0157374_10000708 3300013296 Bacteria 29260
17 Ga0157376_10407254 3300014969 Bacteria 1316
18 Ga0157376_11021554 3300014969 Bacteria 850
19 Ga0207705_10418854 3300025909 Bacteria 1037
20 Ga0207652_10042449 3300025921 Bacteria 3871
21 Ga0207694_10071815 3300025924 Bacteria 2705
22 Ga0207650_10435016 3300025925 Unclassified 1090
23 Ga0207661_10316402 3300025944 Unclassified 1402
24 Ga0207667_11248464 3300025949 Unclassified 721
25 Ga0207667_11909541 3300025949 Unclassified 556
26 Ga0207702_10458655 3300026078 Unclassified 1238
27 Ga0265337_1086171 3300028556 Bacteria 857
28 Ga0265319_1000008 3300028563 Bacteria 215029
29 Ga0265319_1061433 3300028563 Bacteria 1218
30 Ga0265319_1130126 3300028563 Bacteria 782
31 Ga0265319_1152173 3300028563 Unclassified 716
32 Ga0265334_10001636 3300028573 Bacteria 10753
33 Ga0265334_10114568 3300028573 Bacteria 967
34 Ga0265334_10157763 3300028573 Bacteria 798
35 Ga0265334_10205129 3300028573 Unclassified 684
36 Ga0265318_10000007 3300028577 Bacteria 280699
37 Ga0265318_10000453 3300028577 Bacteria 30718
38 Ga0265318_10003614 3300028577 Bacteria 7729
39 Ga0265318_10009111 3300028577 Bacteria 4386
40 Ga0265318_10186236 3300028577 Unclassified 760
41 Ga0265323_10007743 3300028653 Bacteria 4447
42 Ga0265322_10058025 3300028654 Bacteria 1098
43 Ga0265338_10006080 3300028800 Bacteria 15500
44 Ga0265338_10032892 3300028800 Bacteria 5047
45 Ga0265338_10104843 3300028800 Bacteria 2293
46 Ga0265324_10163513 3300029957 Bacteria 756
47 Ga0265330_10058207 3300031235 Bacteria 1685
48 Ga0265330_10061472 3300031235 Bacteria 1634
49 Ga0265330_10120775 3300031235 Bacteria 1116
50 Ga0265330_10141250 3300031235 Unclassified 1024
51 Ga0265332_10038902 3300031238 Bacteria 2060
52 Ga0265328_10187087 3300031239 Unclassified 784
53 Ga0265320_10000997 3300031240 Bacteria 21015
54 Ga0265320_10006027 3300031240 Bacteria 7700
55 Ga0265320_10007664 3300031240 Bacteria 6679
56 Ga0265320_10019535 3300031240 Bacteria 3702
57 Ga0265320_10059838 3300031240 Bacteria 1820
58 Ga0265320_10132010 3300031240 Bacteria 1134
59 Ga0265340_10138048 3300031247 Unclassified 1116
60 Ga0265339_10092496 3300031249 Bacteria 1583
61 Ga0265331_10016283 3300031250 Bacteria 3906
62 Ga0265327_10000023 3300031251 Bacteria 382703
63 Ga0265327_10003015 3300031251 Bacteria 16693
64 Ga0265327_10017943 3300031251 Bacteria 4411
65 Ga0265316_10013795 3300031344 Bacteria 7157
66 Ga0265316_10016862 3300031344 Bacteria 6322
67 Ga0265316_10019028 3300031344 Bacteria 5887
68 Ga0265316_10067311 3300031344 Bacteria 2770
69 Ga0265316_10092540 3300031344 Bacteria 2305
70 Ga0265316_10140813 3300031344 Bacteria 1812
71 Ga0265316_10172328 3300031344 Unclassified 1614
72 Ga0265316_10245784 3300031344 Bacteria 1315
73 Ga0307513_10290710 3300031456 Unclassified 1406
74 Ga0265313_10001595 3300031595 Bacteria 21038
75 Ga0265313_10006198 3300031595 Bacteria 8560
76 Ga0265313_10007588 3300031595 Bacteria 7368
77 Ga0307508_10000399 3300031616 Bacteria 52260
78 Ga0265314_10000588 3300031711 Bacteria 45708
79 Ga0265314_10023029 3300031711 Bacteria 4759
80 Ga0265314_10100060 3300031711 Bacteria 1866
81 Ga0265314_10111432 3300031711 Bacteria 1738
82 Ga0265314_10208507 3300031711 Bacteria 1149
83 Ga0265342_10007553 3300031712 Bacteria 7941
84 Ga0265342_10035333 3300031712 Bacteria 3060
85 Ga0265342_10070705 3300031712 Bacteria 2035
86 Ga0265342_10140023 3300031712 Unclassified 1350
87 Ga0265342_10307854 3300031712 Bacteria 833
88 Ga0373955_0775764 3300035172 Unclassified 589
89 Ga0373924_0356529 3300035410 Unclassified 652
90 Ga0373935_0079932 3300035692 Bacteria 2123
91 Ga0373933_0250677 3300035724 Bacteria 1140
92 Ga0373937_0296506 3300036401 Unclassified 1528
93 Ga0395899_0127308 3300037312 Unclassified 1821
94 Ga0395900_0244398 3300037418 Bacteria 1799
95 Ga0395901_0531013 3300038443 Unclassified 1194
96 Ga0436365_0377771 3300039437 Unclassified 531
97 Ga0439461_0035208 3300041410 Bacteria 1061
98 Ga0451577_0000967 3300042876 Bacteria 42024
99 Ga0451577_0054144 3300042876 Bacteria 3582
100 Ga0451577_0148550 3300042876 Bacteria 2108
101 Ga0451577_0690333 3300042876 Unclassified 925
102 Ga0453683_0000979 3300044673 Bacteria 26963
103 Ga0453683_0052288 3300044673 Bacteria 2558
104 Ga0466966_0073752 3300044684 Unclassified 2134
105 Ga0453684_0000001 3300044712 Bacteria 2623166
106 Ga0453684_0008107 3300044712 Bacteria 18986
107 Ga0453684_0009570 3300044712 Bacteria 16909
108 Ga0453684_0020797 3300044712 Bacteria 9863
109 Ga0453684_0071739 3300044712 Bacteria 4377
110 Ga0453684_0179783 3300044712 Bacteria 2484
111 Ga0466959_0651097 3300045049 Unclassified 707
112 Ga0451576_0002023 3300045051 Bacteria 32041
113 Ga0451576_0005000 3300045051 Bacteria 16855
114 Ga0451576_0546272 3300045051 Bacteria 1217
115 Ga0451576_0668547 3300045051 Bacteria 1091
116 Ga0451576_0977160 3300045051 Bacteria 888
117 Ga0451576_1308071 3300045051 Unclassified 756
118 Ga0451576_2192178 3300045051 Bacteria 567
119 Ga0495630_0053587 3300046517 Bacteria 3021
120 Ga0495652_0767095 3300046529 Unclassified 644
121 Ga0495581_0458998 3300047315 Bacteria 742
122 Ga0495674_0245876 3300047319 Bacteria 1473
123 Ga0495680_0843744 3300047322 Unclassified 596
124 Ga0495684_0658382 3300047471 Bacteria 699
125 Ga0501031_0629218 3300049568 Unclassified 690
126 Ga0501032_0000895 3300049569 Bacteria 24175
127 Ga0501032_0002466 3300049569 Bacteria 14448
128 Ga0501032_0019214 3300049569 Bacteria 4781
129 Ga0501033_0001025 3300049570 Bacteria 25401
130 Ga0501033_0001898 3300049570 Bacteria 18175
131 Ga0501034_0520352 3300049571 Bacteria 1101
132 Ga0501034_1264604 3300049571 Bacteria 615
133 Ga0501036_0014114 3300049572 Bacteria 6642
134 Ga0501037_0016289 3300049573 Bacteria 5472
135 Ga0501037_0027711 3300049573 Bacteria 4186
136 Ga0501038_0005717 3300049574 Bacteria 11533
137 Ga0501038_0053030 3300049574 Bacteria 3494
138 Ga0501038_0905118 3300049574 Bacteria 651
139 Ga0501039_0030354 3300049575 Bacteria 4168
140 Ga0501039_1155057 3300049575 Bacteria 599
141 Ga0501040_0359923 3300049576 Bacteria 1043
142 Ga0501042_0057948 3300049578 Bacteria 2764
143 Ga0501046_0002525 3300049580 Bacteria 17119
144 Ga0501046_0021469 3300049580 Bacteria 5328
145 Ga0501047_0016458 3300049581 Bacteria 7060
146 Ga0501047_0041071 3300049581 Bacteria 4470
147 Ga0501047_0054702 3300049581 Bacteria 3860
148 Ga0501047_0602810 3300049581 Bacteria 920
149 Ga0501048_0010667 3300049582 Bacteria 6853
150 Ga0501048_0523891 3300049582 Bacteria 850
151 Ga0501048_0809239 3300049582 Bacteria 673
152 Ga0501070_0403839 3300049586 Bacteria 1105
153 Ga0501070_0790894 3300049586 Unclassified 745
154 Ga0501073_1097378 3300049589 Bacteria 547
155 Ga0501080_0282324 3300049742 Bacteria 1509
156 Ga0501080_1365703 3300049742 Bacteria 605
157 Ga0501083_0112925 3300049744 Bacteria 1785
158 Ga0501083_0221278 3300049744 Bacteria 1233
159 Ga0501035_0000230 3300049822 Bacteria 66407
160 Ga0501035_0004908 3300049822 Bacteria 12693
161 Ga0501035_0054361 3300049822 Bacteria 3578
162 Ga0501035_0276452 3300049822 Bacteria 1420
163 Ga0501044_0000067 3300049823 Bacteria 126697
164 Ga0501044_0006119 3300049823 Bacteria 13278
165 Ga0501044_0062839 3300049823 Bacteria 3794
166 Ga0501045_0292877 3300049824 Bacteria 1211
167 Ga0500644_0086711 3300053088 Bacteria 1163
168 Ga0500568_0024532 3300053139 Bacteria 2553
169 Ga0500616_0419401 3300053153 Unclassified 532
170 Ga0501082_0484572 3300060353 Bacteria 1081
171 Ga0501082_0989175 3300060353 Bacteria 735
172 Ga0070658_10760564
173 rootH2_10003644
174 rootL2_10147921
175 rootL2_10212667
176 rootL2_10307212
177 Ga0070658_10512891
178 Ga0070683_100366883
179 Ga0070713_100820841
180 Ga0070679_100033990
181 Ga0068856_102078517
182 Ga0068859_102462285
183 Ga0068864_101662483
184 Ga0097620_102461001
185 Ga0105237_11752090
186 Ga0157370_11540638
187 Ga0157374_10000708
188 Ga0157376_10407254
189 Ga0157376_11021554
190 Ga0207705_10418854
191 Ga0207652_10042449
192 Ga0207694_10071815
193 Ga0207650_10435016
194 Ga0207661_10316402
195 Ga0207667_11248464
196 Ga0207667_11909541
197 Ga0207702_10458655
198 Ga0265337_1086171
199 Ga0265319_1000008
200 Ga0265319_1061433
201 Ga0265319_1130126
202 Ga0265319_1152173
203 Ga0265334_10001636
204 Ga0265334_10114568
205 Ga0265334_10157763
206 Ga0265334_10205129
207 Ga0265318_10000007
208 Ga0265318_10000453
209 Ga0265318_10003614
210 Ga0265318_10009111
211 Ga0265318_10186236
212 Ga0265323_10007743
213 Ga0265322_10058025
214 Ga0265338_10006080
215 Ga0265338_10032892
216 Ga0265338_10104843
217 Ga0265324_10163513
218 Ga0265330_10058207
219 Ga0265330_10061472
220 Ga0265330_10120775
221 Ga0265330_10141250
222 Ga0265332_10038902
223 Ga0265328_10187087
224 Ga0265320_10000997
225 Ga0265320_10006027
226 Ga0265320_10007664
227 Ga0265320_10019535
228 Ga0265320_10059838
229 Ga0265320_10132010
230 Ga0265340_10138048
231 Ga0265339_10092496
232 Ga0265331_10016283
233 Ga0265327_10000023
234 Ga0265327_10003015
235 Ga0265327_10017943
236 Ga0265316_10013795
237 Ga0265316_10016862
238 Ga0265316_10019028
239 Ga0265316_10067311
240 Ga0265316_10092540
241 Ga0265316_10140813
242 Ga0265316_10172328
243 Ga0265316_10245784
244 Ga0307513_10290710
245 Ga0265313_10001595
246 Ga0265313_10006198
247 Ga0265313_10007588
248 Ga0307508_10000399
249 Ga0265314_10000588
250 Ga0265314_10023029
251 Ga0265314_10100060
252 Ga0265314_10111432
253 Ga0265314_10208507
254 Ga0265342_10007553
255 Ga0265342_10035333
256 Ga0265342_10070705
257 Ga0265342_10140023
258 Ga0265342_10307854
259 Ga0373955_0775764
260 Ga0373924_0356529
261 Ga0373935_0079932
262 Ga0373933_0250677
263 Ga0373937_0296506
264 Ga0395899_0127308
265 Ga0395900_0244398
266 Ga0395901_0531013
267 Ga0436365_0377771
268 Ga0439461_0035208
269 Ga0451577_0000967
270 Ga0451577_0054144
271 Ga0451577_0148550
272 Ga0451577_0690333
273 Ga0453683_0000979
274 Ga0453683_0052288
275 Ga0466966_0073752
276 Ga0453684_0000001
277 Ga0453684_0008107
278 Ga0453684_0009570
279 Ga0453684_0020797
280 Ga0453684_0071739
281 Ga0453684_0179783
282 Ga0466959_0651097
283 Ga0451576_0002023
284 Ga0451576_0005000
285 Ga0451576_0546272
286 Ga0451576_0668547
287 Ga0451576_0977160
288 Ga0451576_1308071
289 Ga0451576_2192178
290 Ga0495630_0053587
291 Ga0495652_0767095
292 Ga0495581_0458998
293 Ga0495674_0245876
294 Ga0495680_0843744
295 Ga0495684_0658382
296 Ga0501031_0629218
297 Ga0501032_0000895
298 Ga0501032_0002466
299 Ga0501032_0019214
300 Ga0501033_0001025
301 Ga0501033_0001898
302 Ga0501034_0520352
303 Ga0501034_1264604
304 Ga0501036_0014114
305 Ga0501037_0016289
306 Ga0501037_0027711
307 Ga0501038_0005717
308 Ga0501038_0053030
309 Ga0501038_0905118
310 Ga0501039_0030354
311 Ga0501039_1155057
312 Ga0501040_0359923
313 Ga0501042_0057948
314 Ga0501046_0002525
315 Ga0501046_0021469
316 Ga0501047_0016458
317 Ga0501047_0041071
318 Ga0501047_0054702
319 Ga0501047_0602810
320 Ga0501048_0010667
321 Ga0501048_0523891
322 Ga0501048_0809239
323 Ga0501070_0403839
324 Ga0501070_0790894
325 Ga0501073_1097378
326 Ga0501080_0282324
327 Ga0501080_1365703
328 Ga0501083_0112925
329 Ga0501083_0221278
330 Ga0501035_0000230
331 Ga0501035_0004908
332 Ga0501035_0054361
333 Ga0501035_0276452
334 Ga0501044_0000067
335 Ga0501044_0006119
336 Ga0501044_0062839
337 Ga0501045_0292877
338 Ga0500644_0086711
339 Ga0500568_0024532
340 Ga0500616_0419401
341 Ga0501082_0484572
342 Ga0501082_0989175

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00460

Flg_bb_rod

Flagella basal body rod protein

32

55

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nvg-assembly1.cif.gz_q2 salmonella flagellar basal body refined in c1 map 0.7809 13 44
7cgo-assembly1.cif.gz_l cryo-em structure of the flagellar motor-hook complex from salmonella 0.7623 10 121
7nvg-assembly1.cif.gz_l2 salmonella flagellar basal body refined in c1 map 0.7576 9 43
7cg0-assembly1.cif.gz_m cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.7569 10 121
7cg0-assembly1.cif.gz_k cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.7532 10 121
ID Description Score Start End Superfamily
4k7rA01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.6663 9 119 1.20.1600.10
af_A0A0R4IIW2_13_251_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.5894 10 122 1.20.1270.60
af_Q566S5_6_108_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5724 10 124 1.10.287.370
af_Q9V785_7_236_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.568 9 119 1.20.1270.60
af_Q7ZV25_1_108_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5627 1 120 1.20.58.90
ID Description Score Start End GO Terms
AF-B1ZR50-F1-model_v4 Flagellar basal body rod protein FlgB 0.934 1 124 GO:0030694
GO:0071973
AF-A0A2E6TED4-F1-model_v4 Flagellar basal body rod protein FlgB 0.916 9 124 GO:0030694
GO:0071973
AF-B1ZR50-F1-model_v4 Flagellar basal body rod protein FlgB 0.9123 1 124 GO:0030694
GO:0071973
AF-A0A1J4XE88-F1-model_v4 Flagellar basal body rod protein FlgB 0.9004 1 124
AF-A0A2E8UPV7-F1-model_v4 Flagellar basal body rod protein FlgB 0.8956 9 124 GO:0030694
GO:0071973

Map