F257330

General Info

Members Datasets Scaffolds Average Seq Length
170 100 340 106

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0461295|Ga0451576_0461295_935_1279
Length 114
Sequence VGAVHGKAAQGRVNPEPLLQLDRVIHEKGRLGIMSLLAASEELPFTEMRDMLGMTDGNLTTHMRTLQESGYVAVTKSFQKGRALTTYSLTPQGRNAFAKYIDLLEVIVRQSKKK

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
75 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
80 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
81 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
82 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
83 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
88 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
89 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
90 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
91 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
92 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
93 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
94 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
95 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
96 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
97 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
98 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
99 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
100 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.59
Rhizosphere 99.41
Stem 0
Stem Tuber 0
Unclassified 34.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0461295 3300045051 Bacteria 1334
2 Ga0065712_10210373 3300005290 Bacteria 1075
3 Ga0065707_10197317 3300005295 Unclassified 1326
4 Ga0065707_10227918 3300005295 Bacteria 1192
5 Ga0065707_10579036 3300005295 Unclassified 703
6 Ga0065707_11081861 3300005295 Unclassified 520
7 Ga0065707_11155336 3300005295 Unclassified 504
8 Ga0070690_100558656 3300005330 Bacteria 864
9 Ga0070666_10096854 3300005335 Bacteria 2031
10 Ga0070680_100557882 3300005336 Unclassified 982
11 Ga0068868_101933661 3300005338 Unclassified 559
12 Ga0070689_100007259 3300005340 Bacteria 7727
13 Ga0070689_100085207 3300005340 Bacteria 2484
14 Ga0070689_100106434 3300005340 Bacteria 2225
15 Ga0070689_100499819 3300005340 Bacteria 1041
16 Ga0070687_100519906 3300005343 Bacteria 804
17 Ga0070673_100619757 3300005364 Bacteria 988
18 Ga0070688_100019052 3300005365 Bacteria 3972
19 Ga0070688_100021606 3300005365 Unclassified 3761
20 Ga0070688_100169479 3300005365 Unclassified 1505
21 Ga0070705_100139001 3300005440 Bacteria 1596
22 Ga0070700_100299284 3300005441 Unclassified 1174
23 Ga0070700_101058218 3300005441 Unclassified 670
24 Ga0070694_100036127 3300005444 Bacteria 3271
25 Ga0070694_100727036 3300005444 Unclassified 809
26 Ga0070698_100582584 3300005471 Unclassified 1059
27 Ga0070672_101826699 3300005543 Unclassified 547
28 Ga0070695_100764890 3300005545 Bacteria 771
29 Ga0070696_100290912 3300005546 Bacteria 1248
30 Ga0070704_101513600 3300005549 Bacteria 617
31 Ga0068857_100397001 3300005577 Unclassified 1283
32 Ga0068859_100524103 3300005617 Bacteria 1280
33 Ga0068859_101934767 3300005617 Bacteria 651
34 Ga0068859_102113984 3300005617 Bacteria 621
35 Ga0068864_100089596 3300005618 Bacteria 2710
36 Ga0068863_100021410 3300005841 Bacteria 6170
37 Ga0068863_100092116 3300005841 Bacteria 2875
38 Ga0068863_100569616 3300005841 Unclassified 1119
39 Ga0068863_100843019 3300005841 Bacteria 915
40 Ga0068863_101632352 3300005841 Unclassified 654
41 Ga0068862_101254557 3300005844 Bacteria 741
42 Ga0070716_100000003 3300006173 Bacteria 312721
43 Ga0075428_100001470 3300006844 Bacteria 25215
44 Ga0075428_100230493 3300006844 Bacteria 1999
45 Ga0075428_101309614 3300006844 Bacteria 762
46 Ga0075430_101507813 3300006846 Unclassified 552
47 Ga0075430_101632442 3300006846 Unclassified 529
48 Ga0075431_101069501 3300006847 Bacteria 772
49 Ga0075434_100030320 3300006871 Bacteria 5325
50 Ga0075434_100090634 3300006871 Unclassified 3058
51 Ga0075434_100719949 3300006871 Bacteria 1015
52 Ga0075429_100775644 3300006880 Bacteria 840
53 Ga0075429_101393206 3300006880 Unclassified 611
54 Ga0097620_100524158 3300006931 Bacteria 1280
55 Ga0097620_101934526 3300006931 Bacteria 651
56 Ga0097620_102113989 3300006931 Bacteria 621
57 Ga0075435_100031750 3300007076 Bacteria 4165
58 Ga0075435_100205872 3300007076 Unclassified 1668
59 Ga0099794_10538878 3300007265 Unclassified 616
60 Ga0105240_10562968 3300009093 Bacteria 1259
61 Ga0111539_10007782 3300009094 Bacteria 13681
62 Ga0111539_10741124 3300009094 Bacteria 1144
63 Ga0111539_11468578 3300009094 Unclassified 791
64 Ga0105245_12321404 3300009098 Unclassified 590
65 Ga0105247_10539545 3300009101 Unclassified 856
66 Ga0105247_11731349 3300009101 Unclassified 518
67 Ga0114129_10223524 3300009147 Bacteria 2539
68 Ga0114129_10632603 3300009147 Unclassified 1383
69 Ga0114129_10907904 3300009147 Unclassified 1116
70 Ga0114129_11023518 3300009147 Unclassified 1039
71 Ga0114129_13316394 3300009147 Bacteria 520
72 Ga0105243_10986268 3300009148 Unclassified 844
73 Ga0105242_11785493 3300009176 Unclassified 653
74 Ga0105248_10620347 3300009177 Bacteria 1220
75 Ga0105237_11316258 3300009545 Bacteria 729
76 Ga0105249_10635785 3300009553 Unclassified 1124
77 Ga0105249_10843674 3300009553 Unclassified 982
78 Ga0105249_11191925 3300009553 Bacteria 832
79 Ga0157369_10475823 3300013105 Unclassified 1293
80 Ga0163162_10124813 3300013306 Bacteria 2680
81 Ga0163162_12345743 3300013306 Unclassified 613
82 Ga0157375_10371489 3300013308 Bacteria 1596
83 Ga0157375_12306549 3300013308 Bacteria 642
84 Ga0163163_10169904 3300014325 Bacteria 2227
85 Ga0163163_10477034 3300014325 Bacteria 1308
86 Ga0163163_10692347 3300014325 Unclassified 1083
87 Ga0163163_11138790 3300014325 Unclassified 843
88 Ga0157380_12928079 3300014326 Unclassified 543
89 Ga0157377_11027496 3300014745 Unclassified 626
90 Ga0207680_10140806 3300025903 Unclassified 1599
91 Ga0207645_10923072 3300025907 Unclassified 593
92 Ga0207671_11097504 3300025914 Bacteria 625
93 Ga0207686_11526368 3300025934 Bacteria 551
94 Ga0207670_10060843 3300025936 Bacteria 2574
95 Ga0207670_10081775 3300025936 Bacteria 2262
96 Ga0207665_10000009 3300025939 Bacteria 162252
97 Ga0207691_11244801 3300025940 Unclassified 616
98 Ga0207711_10814080 3300025941 Bacteria 870
99 Ga0207712_10280835 3300025961 Bacteria 1359
100 Ga0207712_10342117 3300025961 Unclassified 1241
101 Ga0207640_10672315 3300025981 Bacteria 885
102 Ga0207641_10822732 3300026088 Bacteria 919
103 Ga0207676_10115635 3300026095 Bacteria 2253
104 Ga0207674_10189884 3300026116 Bacteria 2004
105 Ga0207428_10161766 3300027907 Bacteria 1699
106 Ga0207428_10712540 3300027907 Bacteria 717
107 Ga0268265_10581196 3300028380 Unclassified 1068
108 Ga0268265_11058545 3300028380 Bacteria 804
109 Ga0265322_10156249 3300028654 Bacteria 652
110 Ga0265338_10041560 3300028800 Bacteria 4298
111 Ga0265324_10046571 3300029957 Bacteria 1492
112 Ga0265324_10287173 3300029957 Unclassified 559
113 Ga0265320_10268033 3300031240 Bacteria 756
114 Ga0265329_10000279 3300031242 Bacteria 27064
115 Ga0265340_10310097 3300031247 Bacteria 699
116 Ga0265316_10434713 3300031344 Bacteria 942
117 Ga0265314_10000020 3300031711 Bacteria 307052
118 Ga0307416_101003113 3300032002 Unclassified 938
119 Ga0373935_0347478 3300035692 Bacteria 1057
120 Ga0451800_1400944 3300041459 Bacteria 565
121 Ga0451577_0032765 3300042876 Bacteria 4683
122 Ga0451577_0148393 3300042876 Bacteria 2109
123 Ga0451577_0537191 3300042876 Bacteria 1062
124 Ga0451577_0850996 3300042876 Bacteria 823
125 Ga0451577_1075022 3300042876 Unclassified 721
126 Ga0453684_0012632 3300044712 Bacteria 13884
127 Ga0453684_0863734 3300044712 Bacteria 971
128 Ga0453684_1546887 3300044712 Bacteria 683
129 Ga0451576_0093575 3300045051 Bacteria 3125
130 Ga0451576_0149714 3300045051 Bacteria 2434
131 Ga0451576_0277373 3300045051 Bacteria 1753
132 Ga0451576_0353526 3300045051 Unclassified 1538
133 Ga0451576_0796723 3300045051 Unclassified 992
134 Ga0451576_1594558 3300045051 Bacteria 677
135 Ga0466958_0099900 3300045836 Unclassified 1803
136 Ga0495634_0427494 3300046642 Unclassified 784
137 Ga0495599_0097168 3300046678 Bacteria 1836
138 Ga0495647_0197754 3300046681 Bacteria 881
139 Ga0495658_0011407 3300046683 Bacteria 4469
140 Ga0495674_0970513 3300047319 Unclassified 653
141 Ga0501039_0862017 3300049575 Bacteria 706
142 Ga0501041_0223115 3300049577 Bacteria 1183
143 Ga0501048_0426669 3300049582 Bacteria 949
144 Ga0501070_1546605 3300049586 Bacteria 501
145 Ga0501075_0067493 3300049591 Bacteria 2701
146 Ga0501076_0522371 3300049592 Bacteria 979
147 Ga0501081_0122977 3300049743 Bacteria 1850
148 Ga0501081_0457544 3300049743 Bacteria 948
149 Ga0501272_023918 3300049769 Unclassified 747
150 nmdc:mga05p37_2158411_c1 3300050507 Bacteria 519
151 nmdc:mga05p37_280984_c1 3300050507 Bacteria 1985
152 nmdc:mga05p37_745014_c1 3300050507 Unclassified 1081
153 nmdc:mga05p37_989569_c1 3300050507 Unclassified 895
154 nmdc:mga09592_881994_c1 3300050508 Bacteria 753
155 nmdc:mga09592_981469_c1 3300050508 Bacteria 707
156 nmdc:mga06r32_466775_c1 3300050510 Bacteria 1241
157 nmdc:mga06r32_918401_c1 3300050510 Bacteria 831
158 nmdc:mga08y16_1831393_c1 3300050511 Unclassified 559
159 nmdc:mga08y16_2143476_c1 3300050511 Unclassified 506
160 nmdc:mga08y16_739096_c1 3300050511 Bacteria 981
161 nmdc:mga08y16_9226_c1 3300050511 Bacteria 10351
162 nmdc:mga0n895_229877_c1 3300050512 Bacteria 1883
163 nmdc:mga0n895_674742_c1 3300050512 Bacteria 1031
164 nmdc:mga0n895_92474_c1 3300050512 Unclassified 3027
165 nmdc:mga0rr50_29284_c1 3300050513 Bacteria 3881
166 nmdc:mga0rr50_70392_c1 3300050513 Unclassified 2665
167 nmdc:mga0a205_450143_c1 3300050515 Bacteria 1147
168 Ga0501084_0596193 3300054114 Bacteria 934
169 Ga0501082_1450742 3300060353 Bacteria 599
170 Ga0501082_1468638 3300060353 Bacteria 595
171 Ga0451576_0461295
172 Ga0065712_10210373
173 Ga0065707_10197317
174 Ga0065707_10227918
175 Ga0065707_10579036
176 Ga0065707_11081861
177 Ga0065707_11155336
178 Ga0070690_100558656
179 Ga0070666_10096854
180 Ga0070680_100557882
181 Ga0068868_101933661
182 Ga0070689_100007259
183 Ga0070689_100085207
184 Ga0070689_100106434
185 Ga0070689_100499819
186 Ga0070687_100519906
187 Ga0070673_100619757
188 Ga0070688_100019052
189 Ga0070688_100021606
190 Ga0070688_100169479
191 Ga0070705_100139001
192 Ga0070700_100299284
193 Ga0070700_101058218
194 Ga0070694_100036127
195 Ga0070694_100727036
196 Ga0070698_100582584
197 Ga0070672_101826699
198 Ga0070695_100764890
199 Ga0070696_100290912
200 Ga0070704_101513600
201 Ga0068857_100397001
202 Ga0068859_100524103
203 Ga0068859_101934767
204 Ga0068859_102113984
205 Ga0068864_100089596
206 Ga0068863_100021410
207 Ga0068863_100092116
208 Ga0068863_100569616
209 Ga0068863_100843019
210 Ga0068863_101632352
211 Ga0068862_101254557
212 Ga0070716_100000003
213 Ga0075428_100001470
214 Ga0075428_100230493
215 Ga0075428_101309614
216 Ga0075430_101507813
217 Ga0075430_101632442
218 Ga0075431_101069501
219 Ga0075434_100030320
220 Ga0075434_100090634
221 Ga0075434_100719949
222 Ga0075429_100775644
223 Ga0075429_101393206
224 Ga0097620_100524158
225 Ga0097620_101934526
226 Ga0097620_102113989
227 Ga0075435_100031750
228 Ga0075435_100205872
229 Ga0099794_10538878
230 Ga0105240_10562968
231 Ga0111539_10007782
232 Ga0111539_10741124
233 Ga0111539_11468578
234 Ga0105245_12321404
235 Ga0105247_10539545
236 Ga0105247_11731349
237 Ga0114129_10223524
238 Ga0114129_10632603
239 Ga0114129_10907904
240 Ga0114129_11023518
241 Ga0114129_13316394
242 Ga0105243_10986268
243 Ga0105242_11785493
244 Ga0105248_10620347
245 Ga0105237_11316258
246 Ga0105249_10635785
247 Ga0105249_10843674
248 Ga0105249_11191925
249 Ga0157369_10475823
250 Ga0163162_10124813
251 Ga0163162_12345743
252 Ga0157375_10371489
253 Ga0157375_12306549
254 Ga0163163_10169904
255 Ga0163163_10477034
256 Ga0163163_10692347
257 Ga0163163_11138790
258 Ga0157380_12928079
259 Ga0157377_11027496
260 Ga0207680_10140806
261 Ga0207645_10923072
262 Ga0207671_11097504
263 Ga0207686_11526368
264 Ga0207670_10060843
265 Ga0207670_10081775
266 Ga0207665_10000009
267 Ga0207691_11244801
268 Ga0207711_10814080
269 Ga0207712_10280835
270 Ga0207712_10342117
271 Ga0207640_10672315
272 Ga0207641_10822732
273 Ga0207676_10115635
274 Ga0207674_10189884
275 Ga0207428_10161766
276 Ga0207428_10712540
277 Ga0268265_10581196
278 Ga0268265_11058545
279 Ga0265322_10156249
280 Ga0265338_10041560
281 Ga0265324_10046571
282 Ga0265324_10287173
283 Ga0265320_10268033
284 Ga0265329_10000279
285 Ga0265340_10310097
286 Ga0265316_10434713
287 Ga0265314_10000020
288 Ga0307416_101003113
289 Ga0373935_0347478
290 Ga0451800_1400944
291 Ga0451577_0032765
292 Ga0451577_0148393
293 Ga0451577_0537191
294 Ga0451577_0850996
295 Ga0451577_1075022
296 Ga0453684_0012632
297 Ga0453684_0863734
298 Ga0453684_1546887
299 Ga0451576_0093575
300 Ga0451576_0149714
301 Ga0451576_0277373
302 Ga0451576_0353526
303 Ga0451576_0796723
304 Ga0451576_1594558
305 Ga0466958_0099900
306 Ga0495634_0427494
307 Ga0495599_0097168
308 Ga0495647_0197754
309 Ga0495658_0011407
310 Ga0495674_0970513
311 Ga0501039_0862017
312 Ga0501041_0223115
313 Ga0501048_0426669
314 Ga0501070_1546605
315 Ga0501075_0067493
316 Ga0501076_0522371
317 Ga0501081_0122977
318 Ga0501081_0457544
319 Ga0501272_023918
320 nmdc:mga05p37_2158411_c1
321 nmdc:mga05p37_280984_c1
322 nmdc:mga05p37_745014_c1
323 nmdc:mga05p37_989569_c1
324 nmdc:mga09592_881994_c1
325 nmdc:mga09592_981469_c1
326 nmdc:mga06r32_466775_c1
327 nmdc:mga06r32_918401_c1
328 nmdc:mga08y16_1831393_c1
329 nmdc:mga08y16_2143476_c1
330 nmdc:mga08y16_739096_c1
331 nmdc:mga08y16_9226_c1
332 nmdc:mga0n895_229877_c1
333 nmdc:mga0n895_674742_c1
334 nmdc:mga0n895_92474_c1
335 nmdc:mga0rr50_29284_c1
336 nmdc:mga0rr50_70392_c1
337 nmdc:mga0a205_450143_c1
338 Ga0501084_0596193
339 Ga0501082_1450742
340 Ga0501082_1468638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13601

HTH_34

Winged helix DNA-binding domain

30

108

0.98

PF01022

HTH_5

Bacterial regulatory protein, arsR family

27

74

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ub9-assembly1.cif.gz_A-2 structure of the transcriptional regulator homologue protein from pyrococcus horikoshii ot3 0.9648 12 101
4hob-assembly1.cif.gz_A the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9344 15 58
1s3j-assembly1.cif.gz_B x-ray crystal structure of yuso protein from bacillus subtilis 0.9217 16 100
6wxq-assembly1.cif.gz_A crystal structure of crispr-associated transcription factor csa3 complexed with ca4 0.9101 14 86
3pqj-assembly2.cif.gz_C crystal structure of the transcriptional repressor bigr from xylella fastidiosa 0.9094 12 91
ID Description Score Start End Superfamily
1ub9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9648 12 101 1.10.10.10
af_Q9C106_1_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9435 20 78 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9429 12 79 1.10.10.10
5dukA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.94 18 57 1.10.10.10
4hobA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9344 15 58 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A381T0B5-F1-model_v4 Winged helix DNA-binding domain-containing protein 1.002 13 100
AF-A0A7Y5T102-F1-model_v4 Transcriptional regulator 0.9964 10 97 GO:0005737
AF-A0A496U1N9-F1-model_v4 Transcriptional regulator 0.9957 8 97 GO:0003700
AF-A0A7C7QE03-F1-model_v4 Transcriptional regulator 0.9956 8 101
AF-A0A352F663-F1-model_v4 ArsR family transcriptional regulator 0.9955 5 93 GO:0005737

Map