F257296

General Info

Members Datasets Scaffolds Average Seq Length
170 121 340 222

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0023057|Ga0466961_0023057_2390_3109
Length 239
Sequence MSRVKLAPSILSADFARLGEQIREAEAGGADWIHVDVMDGHFVPNITIGPLIAAAAKRSTSRIIDVHLMIEHPERYLEAFAQAGADHLTVHVETCPHLHRTVQQIRELGVKPGVTLNPATPVESLTEVLPYVDLVLVMSVNPGFGGQSYIPTSTAKIAKVRRMLDERGLSHVELEVDGGVGPENAAEVVRAGATALVAGSAVYNAKASVAENLRRLREAAEQGARVTVDRSGRADYLSR

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
59 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
60 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
61 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
62 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
63 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
68 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
73 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
74 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
75 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
77 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
78 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
94 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
105 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
108 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
109 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
115 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
116 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
118 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
119 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
120 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
121 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 0.59
Isolates 1.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.12
Nodule 0
Rhizoplane 1.18
Rhizosphere 91.18
Stem 0
Stem Tuber 0
Unclassified 3.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0023057 3300044693 Bacteria 4003
2 JGI25406J46586_10013916 3300003203 Bacteria 3435
3 JGI25406J46586_10046554 3300003203 Bacteria 1485
4 Ga0055538_1000312 3300003751 Bacteria 23138
5 JGI25405J52794_10045352 3300003911 Bacteria 936
6 Ga0070690_100153635 3300005330 Bacteria 1572
7 Ga0070682_100325818 3300005337 Bacteria 1136
8 Ga0068868_100209855 3300005338 Unclassified 1627
9 Ga0070689_100772365 3300005340 Bacteria 843
10 Ga0070688_100365067 3300005365 Bacteria 1060
11 Ga0070705_100058765 3300005440 Bacteria 2274
12 Ga0070700_100070571 3300005441 Bacteria 2228
13 Ga0070663_100003553 3300005455 Bacteria 9005
14 Ga0070662_100027150 3300005457 Bacteria 3971
15 Ga0068867_100004197 3300005459 Bacteria 10138
16 Ga0070685_10014188 3300005466 Bacteria 4214
17 Ga0070685_10039603 3300005466 Bacteria 2678
18 Ga0070685_10041487 3300005466 Bacteria 2622
19 Ga0070707_100000023 3300005468 Bacteria 128989
20 Ga0070699_100029050 3300005518 Bacteria 4766
21 Ga0070686_100000670 3300005544 Bacteria 19961
22 Ga0070704_100650977 3300005549 Bacteria 930
23 Ga0070664_100271623 3300005564 Bacteria 1527
24 Ga0070702_100300368 3300005615 Bacteria 1110
25 Ga0068859_100050032 3300005617 Bacteria 4198
26 Ga0068861_100023922 3300005719 Unclassified 4412
27 Ga0068870_10199950 3300005840 Bacteria 1211
28 Ga0068863_100463037 3300005841 Bacteria 1245
29 Ga0068860_100330975 3300005843 Bacteria 1496
30 Ga0081455_10008956 3300005937 Bacteria 10341
31 Ga0081455_10035001 3300005937 Bacteria 4494
32 Ga0081540_1061792 3300005983 Bacteria 1784
33 Ga0081540_1085940 3300005983 Bacteria 1399
34 Ga0081539_10000929 3300005985 Bacteria 55001
35 Ga0081539_10000959 3300005985 Bacteria 54051
36 Ga0081539_10001069 3300005985 Bacteria 50060
37 Ga0075366_10232352 3300006195 Bacteria 1124
38 Ga0075428_100082331 3300006844 Bacteria 3512
39 Ga0075428_100330316 3300006844 Bacteria 1638
40 Ga0075428_100652208 3300006844 Bacteria 1122
41 Ga0075430_100086477 3300006846 Bacteria 2624
42 Ga0075431_100001627 3300006847 Bacteria 20992
43 Ga0075431_100101497 3300006847 Bacteria 2968
44 Ga0075431_100180679 3300006847 Bacteria 2165
45 Ga0075434_100472261 3300006871 Bacteria 1275
46 Ga0097620_100050031 3300006931 Bacteria 4198
47 Ga0111539_10055330 3300009094 Bacteria 4716
48 Ga0114129_10069063 3300009147 Bacteria 4925
49 Ga0114129_10581748 3300009147 Bacteria 1453
50 Ga0114129_10784076 3300009147 Bacteria 1217
51 Ga0105238_10025740 3300009551 Bacteria 5999
52 Ga0105249_10198142 3300009553 Bacteria 1964
53 Ga0105246_10159559 3300011119 Bacteria 1717
54 Ga0163163_10014965 3300014325 Bacteria 7150
55 Ga0157380_10206480 3300014326 Unclassified 1747
56 Ga0163161_10200050 3300017792 Bacteria 1539
57 Ga0209784_100184 3300025224 Bacteria 50021
58 Ga0207662_10036049 3300025918 Bacteria 2890
59 Ga0207646_10000077 3300025922 Bacteria 134395
60 Ga0207694_10000228 3300025924 Bacteria 54410
61 Ga0207706_10000328 3300025933 Bacteria 51538
62 Ga0207670_10043261 3300025936 Bacteria 2973
63 Ga0207677_10077250 3300026023 Bacteria 2374
64 Ga0207678_10005963 3300026067 Bacteria 10851
65 Ga0207708_10135942 3300026075 Bacteria 1925
66 Ga0207641_10441486 3300026088 Bacteria 1256
67 Ga0207674_10716854 3300026116 Bacteria 965
68 Ga0207675_100003537 3300026118 Bacteria 15246
69 Ga0207428_10103305 3300027907 Bacteria 2200
70 Ga0268264_10160935 3300028381 Bacteria 2022
71 Ga0265330_10008058 3300031235 Bacteria 5096
72 Ga0265332_10001209 3300031238 Bacteria 14937
73 Ga0265328_10001391 3300031239 Bacteria 11143
74 Ga0265320_10003262 3300031240 Bacteria 10967
75 Ga0265329_10001254 3300031242 Bacteria 12413
76 Ga0265331_10001594 3300031250 Bacteria 16569
77 Ga0265316_10003940 3300031344 Bacteria 14873
78 Ga0307408_100212931 3300031548 Bacteria 1572
79 Ga0265313_10053707 3300031595 Bacteria 1917
80 Ga0316575_10002737 3300031665 Bacteria 5950
81 Ga0316579_10005780 3300031691 Bacteria 5013
82 Ga0316579_10022257 3300031691 Bacteria 2833
83 Ga0316579_10125525 3300031691 Bacteria 1235
84 Ga0316579_10218388 3300031691 Bacteria 922
85 Ga0265314_10014448 3300031711 Bacteria 6316
86 Ga0265342_10003585 3300031712 Bacteria 12666
87 Ga0316576_10039724 3300031727 Bacteria 3379
88 Ga0316576_10063821 3300031727 Bacteria 2704
89 Ga0316576_10526014 3300031727 Bacteria 868
90 Ga0316578_10121219 3300031728 Bacteria 1572
91 Ga0316578_10161858 3300031728 Bacteria 1349
92 Ga0316577_10000149 3300031733 Bacteria 21429
93 Ga0316577_10012155 3300031733 Bacteria 4684
94 Ga0316577_10044050 3300031733 Bacteria 2495
95 Ga0316577_10072229 3300031733 Bacteria 1926
96 Ga0316577_10090766 3300031733 Bacteria 1710
97 Ga0316577_10102272 3300031733 Bacteria 1606
98 Ga0316577_10104101 3300031733 Bacteria 1592
99 Ga0316577_10213595 3300031733 Bacteria 1090
100 Ga0316583_10159149 3300032133 Bacteria 786
101 Ga0316593_10005121 3300032168 Bacteria 3429
102 Ga0373959_0000173 3300034820 Bacteria 14549
103 Ga0373961_0067068 3300035241 Bacteria 1102
104 Ga0316574_0069760 3300035398 Unclassified 2219
105 Ga0373933_0022611 3300035724 Unclassified 3583
106 Ga0373937_0198639 3300036401 Bacteria 1885
107 Ga0316582_0001458 3300036647 Bacteria 10394
108 Ga0316582_0020987 3300036647 Bacteria 3850
109 Ga0316582_0246897 3300036647 Bacteria 1223
110 Ga0316584_0002477 3300036712 Bacteria 11687
111 Ga0316584_0010036 3300036712 Bacteria 6598
112 Ga0316584_0012014 3300036712 Bacteria 6099
113 Ga0316584_0021884 3300036712 Bacteria 4655
114 Ga0316584_0023916 3300036712 Bacteria 4466
115 Ga0316584_0053721 3300036712 Bacteria 3015
116 Ga0316584_0135758 3300036712 Bacteria 1836
117 Ga0316584_0200215 3300036712 Bacteria 1474
118 Ga0316584_0243215 3300036712 Bacteria 1316
119 Ga0316584_0333195 3300036712 Unclassified 1092
120 Ga0316584_0531032 3300036712 Bacteria 823
121 Ga0395905_0236712 3300037471 Bacteria 1706
122 Ga0316581_0000515 3300037588 Bacteria 7495
123 Ga0316581_0003348 3300037588 Bacteria 3981
124 Ga0316581_0035658 3300037588 Bacteria 1508
125 Ga0395901_0032107 3300038443 Bacteria 5418
126 Ga0400489_02806 3300039093 Bacteria 8902
127 Ga0400489_19183 3300039093 Bacteria 1711
128 Ga0436365_1428601 3300039437 Bacteria 889
129 Ga0466969_0081041 3300044656 Bacteria 1549
130 Ga0453683_0018246 3300044673 Bacteria 4506
131 Ga0453683_0539410 3300044673 Bacteria 758
132 Ga0453684_0194477 3300044712 Bacteria 2370
133 Ga0453684_0446174 3300044712 Bacteria 1441
134 Ga0453684_0661253 3300044712 Bacteria 1139
135 Ga0451576_0266277 3300045051 Bacteria 1791
136 Ga0466967_0467626 3300045976 Bacteria 1234
137 Ga0495643_0000059 3300046522 Bacteria 192508
138 Ga0495615_0028690 3300048090 Bacteria 1315
139 Ga0496109_0000023 3300048912 Bacteria 187904
140 Ga0496112_0012372 3300048915 Bacteria 7840
141 Ga0501034_0110247 3300049571 Bacteria 2743
142 Ga0501036_0265446 3300049572 Bacteria 1438
143 Ga0501037_0120460 3300049573 Bacteria 1887
144 Ga0501038_0039752 3300049574 Bacteria 4114
145 Ga0501040_0235641 3300049576 Bacteria 1304
146 Ga0501047_0017341 3300049581 Bacteria 6896
147 Ga0501070_0149986 3300049586 Bacteria 1924
148 Ga0501077_0007387 3300049593 Bacteria 6775
149 Ga0501258_020405 3300049687 Bacteria 776
150 Ga0501044_0459722 3300049823 Bacteria 1178
151 nmdc:mga0k408_215712_c1 3300050493 Bacteria 1146
152 nmdc:mga05p37_38756_c1 3300050507 Bacteria 5847
153 nmdc:mga0qj67_193949_c1 3300050509 Bacteria 1650
154 nmdc:mga0qj67_267910_c1 3300050509 Bacteria 1385
155 nmdc:mga06r32_142504_c1 3300050510 Bacteria 2374
156 nmdc:mga06r32_262999_c1 3300050510 Bacteria 1713
157 nmdc:mga06r32_38047_c1 3300050510 Bacteria 4555
158 nmdc:mga06r32_4590_c1 3300050510 Bacteria 12385
159 nmdc:mga08y16_10833_c1 3300050511 Bacteria 9574
160 nmdc:mga08y16_174605_c1 3300050511 Bacteria 2231
161 nmdc:mga0n895_852424_c1 3300050512 Bacteria 899
162 nmdc:mga0a205_272651_c1 3300050515 Bacteria 1569
163 Ga0500555_009922 3300053103 Bacteria 2724
164 Ga0500617_096304 3300053124 Bacteria 1258
165 Ga0500628_003161 3300053129 Bacteria 2709
166 Ga0501084_0096609 3300054114 Bacteria 2481
167 Ga0530510_0335398 3300061734 Bacteria 1135
168 2573040782 2571042588 Bacteria 5045676
169 2580929968 2579778775 Bacteria 5360914
170 2621274990 2619619294 Bacteria 5575484
171 Ga0466961_0023057
172 JGI25406J46586_10013916
173 JGI25406J46586_10046554
174 Ga0055538_1000312
175 JGI25405J52794_10045352
176 Ga0070690_100153635
177 Ga0070682_100325818
178 Ga0068868_100209855
179 Ga0070689_100772365
180 Ga0070688_100365067
181 Ga0070705_100058765
182 Ga0070700_100070571
183 Ga0070663_100003553
184 Ga0070662_100027150
185 Ga0068867_100004197
186 Ga0070685_10014188
187 Ga0070685_10039603
188 Ga0070685_10041487
189 Ga0070707_100000023
190 Ga0070699_100029050
191 Ga0070686_100000670
192 Ga0070704_100650977
193 Ga0070664_100271623
194 Ga0070702_100300368
195 Ga0068859_100050032
196 Ga0068861_100023922
197 Ga0068870_10199950
198 Ga0068863_100463037
199 Ga0068860_100330975
200 Ga0081455_10008956
201 Ga0081455_10035001
202 Ga0081540_1061792
203 Ga0081540_1085940
204 Ga0081539_10000929
205 Ga0081539_10000959
206 Ga0081539_10001069
207 Ga0075366_10232352
208 Ga0075428_100082331
209 Ga0075428_100330316
210 Ga0075428_100652208
211 Ga0075430_100086477
212 Ga0075431_100001627
213 Ga0075431_100101497
214 Ga0075431_100180679
215 Ga0075434_100472261
216 Ga0097620_100050031
217 Ga0111539_10055330
218 Ga0114129_10069063
219 Ga0114129_10581748
220 Ga0114129_10784076
221 Ga0105238_10025740
222 Ga0105249_10198142
223 Ga0105246_10159559
224 Ga0163163_10014965
225 Ga0157380_10206480
226 Ga0163161_10200050
227 Ga0209784_100184
228 Ga0207662_10036049
229 Ga0207646_10000077
230 Ga0207694_10000228
231 Ga0207706_10000328
232 Ga0207670_10043261
233 Ga0207677_10077250
234 Ga0207678_10005963
235 Ga0207708_10135942
236 Ga0207641_10441486
237 Ga0207674_10716854
238 Ga0207675_100003537
239 Ga0207428_10103305
240 Ga0268264_10160935
241 Ga0265330_10008058
242 Ga0265332_10001209
243 Ga0265328_10001391
244 Ga0265320_10003262
245 Ga0265329_10001254
246 Ga0265331_10001594
247 Ga0265316_10003940
248 Ga0307408_100212931
249 Ga0265313_10053707
250 Ga0316575_10002737
251 Ga0316579_10005780
252 Ga0316579_10022257
253 Ga0316579_10125525
254 Ga0316579_10218388
255 Ga0265314_10014448
256 Ga0265342_10003585
257 Ga0316576_10039724
258 Ga0316576_10063821
259 Ga0316576_10526014
260 Ga0316578_10121219
261 Ga0316578_10161858
262 Ga0316577_10000149
263 Ga0316577_10012155
264 Ga0316577_10044050
265 Ga0316577_10072229
266 Ga0316577_10090766
267 Ga0316577_10102272
268 Ga0316577_10104101
269 Ga0316577_10213595
270 Ga0316583_10159149
271 Ga0316593_10005121
272 Ga0373959_0000173
273 Ga0373961_0067068
274 Ga0316574_0069760
275 Ga0373933_0022611
276 Ga0373937_0198639
277 Ga0316582_0001458
278 Ga0316582_0020987
279 Ga0316582_0246897
280 Ga0316584_0002477
281 Ga0316584_0010036
282 Ga0316584_0012014
283 Ga0316584_0021884
284 Ga0316584_0023916
285 Ga0316584_0053721
286 Ga0316584_0135758
287 Ga0316584_0200215
288 Ga0316584_0243215
289 Ga0316584_0333195
290 Ga0316584_0531032
291 Ga0395905_0236712
292 Ga0316581_0000515
293 Ga0316581_0003348
294 Ga0316581_0035658
295 Ga0395901_0032107
296 Ga0400489_02806
297 Ga0400489_19183
298 Ga0436365_1428601
299 Ga0466969_0081041
300 Ga0453683_0018246
301 Ga0453683_0539410
302 Ga0453684_0194477
303 Ga0453684_0446174
304 Ga0453684_0661253
305 Ga0451576_0266277
306 Ga0466967_0467626
307 Ga0495643_0000059
308 Ga0495615_0028690
309 Ga0496109_0000023
310 Ga0496112_0012372
311 Ga0501034_0110247
312 Ga0501036_0265446
313 Ga0501037_0120460
314 Ga0501038_0039752
315 Ga0501040_0235641
316 Ga0501047_0017341
317 Ga0501070_0149986
318 Ga0501077_0007387
319 Ga0501258_020405
320 Ga0501044_0459722
321 nmdc:mga0k408_215712_c1
322 nmdc:mga05p37_38756_c1
323 nmdc:mga0qj67_193949_c1
324 nmdc:mga0qj67_267910_c1
325 nmdc:mga06r32_142504_c1
326 nmdc:mga06r32_262999_c1
327 nmdc:mga06r32_38047_c1
328 nmdc:mga06r32_4590_c1
329 nmdc:mga08y16_10833_c1
330 nmdc:mga08y16_174605_c1
331 nmdc:mga0n895_852424_c1
332 nmdc:mga0a205_272651_c1
333 Ga0500555_009922
334 Ga0500617_096304
335 Ga0500628_003161
336 Ga0501084_0096609
337 Ga0530510_0335398
338 2573040782
339 2580929968
340 2621274990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

5

203

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.977 1 215
7b1w-assembly2.cif.gz_K-3 crystal structure of plastidial ribulose epimerase rpe1 from the model alga chlamydomonas reinhardtii 0.9729 2 212
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9722 1 219
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9715 3 219
1rpx-assembly1.cif.gz_A d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts 0.9706 2 215
ID Description Score Start End Superfamily
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9852 1 216 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9767 1 215 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9689 2 215 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9673 1 216 3.20.20.70
af_A0A1D6PJ99_41_293_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9672 2 208 3.20.20.70
ID Description Score Start End GO Terms
AF-G2LHA7-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.996 2 216 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A7Y4UCZ2-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9954 1 187 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A1Q7AZI5-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9929 2 214 GO:0004750
GO:0006098
GO:0016209
GO:0016491
GO:0019323
GO:0046872
AF-A0A537JAB8-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9926 2 216 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A3N5IL17-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9925 34 217 GO:0004750
GO:0005975
GO:0006098
GO:0046872

Map