F257203

General Info

Members Datasets Scaffolds Average Seq Length
170 121 340 292

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0933080|Ga0436364_0933080_120_1058
Length 312
Sequence LLARAGQTPPAGFAREDESVMPPLLKSRVVGFPVRRGKVRDVYDLGDRLVIVATDRISAFDWVLPTPIPDKGRVLTALTLFWLKKLAPANHLLSTDLRDMPAGFAAHADELEGRTCLVRKARVAPIECVVRGYLAGSGWKEYRTTGKVCGVALPAGLRLSERLPAPIFTPSTKEEQGHDQNITYEEAAARVGAAAAAQLRDRSIDLYHRAADYAASRGVILADTKFEWGWTPDGELILVDEVLTPDSSRFWPADGSAAGANPPSFDKQYVRDWLETSGWDKNSPPPPLPEEVVRRTREKYLEALARLKGNET

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
3 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
49 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
52 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
53 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
54 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
55 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
56 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
57 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
58 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
59 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
60 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
61 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
64 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
65 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
66 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
67 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
68 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
69 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
70 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
71 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
72 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
73 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
74 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
75 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
76 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
77 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
78 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
79 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
82 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
83 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
84 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
85 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
86 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
87 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
90 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
102 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
114 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
115 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
116 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
117 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
121 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 12.35
Rhizosphere 81.76
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0933080 3300037853 Bacteria 1765
2 Ga0055541_1002089 3300003841 Bacteria 4077
3 Ga0070675_100058778 3300005354 Bacteria 3172
4 Ga0070675_100077792 3300005354 Bacteria 2762
5 Ga0070674_100026907 3300005356 Bacteria 3764
6 Ga0070714_100218625 3300005435 Bacteria 1750
7 Ga0070713_100053612 3300005436 Bacteria 3342
8 Ga0070708_100017539 3300005445 Bacteria 5977
9 Ga0070706_100008007 3300005467 Bacteria 9858
10 Ga0070706_100013839 3300005467 Bacteria 7460
11 Ga0070706_100015536 3300005467 Bacteria 7032
12 Ga0070707_100002513 3300005468 Bacteria 17468
13 Ga0070698_100078884 3300005471 Bacteria 3291
14 Ga0070698_100119243 3300005471 Bacteria 2599
15 Ga0070698_100266119 3300005471 Bacteria 1646
16 Ga0070697_100033826 3300005536 Bacteria 4119
17 Ga0070697_100118588 3300005536 Bacteria 2212
18 Ga0070665_100000153 3300005548 Bacteria 126011
19 Ga0068857_100009267 3300005577 Bacteria 8541
20 Ga0081539_10008049 3300005985 Bacteria 9336
21 Ga0070717_10003971 3300006028 Bacteria 10647
22 Ga0070717_10041683 3300006028 Bacteria 3742
23 Ga0070717_10091677 3300006028 Bacteria 2566
24 Ga0070717_10234625 3300006028 Bacteria 1616
25 Ga0070712_100183178 3300006175 Bacteria 1633
26 Ga0075428_100000289 3300006844 Bacteria 49296
27 Ga0075428_100034747 3300006844 Bacteria 5559
28 Ga0075430_100006159 3300006846 Bacteria 10107
29 Ga0075433_10060413 3300006852 Bacteria 3318
30 Ga0075434_100527856 3300006871 Bacteria 1201
31 Ga0105241_10168058 3300009174 Bacteria 1809
32 Ga0105242_10411059 3300009176 Bacteria 1265
33 Ga0105248_10568744 3300009177 Bacteria 1279
34 Ga0157371_10212041 3300013102 Bacteria 1390
35 Ga0157369_10090284 3300013105 Bacteria 3271
36 Ga0157369_10379690 3300013105 Bacteria 1467
37 Ga0163162_10166928 3300013306 Bacteria 2325
38 Ga0157372_10224563 3300013307 Bacteria 2177
39 Ga0157372_10405059 3300013307 Bacteria 1589
40 Ga0157372_10423906 3300013307 Bacteria 1551
41 Ga0157375_10439020 3300013308 Bacteria 1471
42 Ga0157375_10878418 3300013308 Bacteria 1042
43 Ga0157380_10130140 3300014326 Bacteria 2145
44 Ga0157376_10332348 3300014969 Bacteria 1448
45 Ga0213876_10062350 3300021384 Bacteria 1968
46 Ga0207684_10004816 3300025910 Bacteria 12631
47 Ga0207684_10051617 3300025910 Bacteria 3489
48 Ga0207654_10252271 3300025911 Bacteria 1183
49 Ga0207695_10000845 3300025913 Bacteria 56214
50 Ga0207646_10000325 3300025922 Bacteria 64667
51 Ga0207646_10027190 3300025922 Bacteria 5217
52 Ga0207659_10062106 3300025926 Bacteria 2695
53 Ga0207659_10192876 3300025926 Bacteria 1622
54 Ga0207687_10096587 3300025927 Bacteria 2166
55 Ga0207700_10046320 3300025928 Bacteria 3215
56 Ga0207664_10047152 3300025929 Bacteria 3384
57 Ga0207664_10056234 3300025929 Unclassified 3125
58 Ga0207664_10186291 3300025929 Bacteria 1785
59 Ga0207686_10103661 3300025934 Bacteria 1904
60 Ga0207691_10049643 3300025940 Bacteria 3845
61 Ga0207689_10593544 3300025942 Bacteria 931
62 Ga0207651_10037724 3300025960 Bacteria 3168
63 Ga0207703_10181847 3300026035 Bacteria 1856
64 Ga0207674_10000506 3300026116 Bacteria 51206
65 Ga0268266_10001100 3300028379 Bacteria 33872
66 Ga0268265_10468937 3300028380 Unclassified 1180
67 Ga0316577_10028747 3300031733 Bacteria 3103
68 Ga0307407_10125157 3300031903 Bacteria 1636
69 Ga0307409_100015873 3300031995 Bacteria 4961
70 Ga0307409_100308237 3300031995 Bacteria 1476
71 Ga0316584_0091732 3300036712 Bacteria 2274
72 Ga0316584_0104691 3300036712 Bacteria 2118
73 Ga0395901_0018199 3300038443 Bacteria 7173
74 Ga0395901_0304258 3300038443 Bacteria 1653
75 Ga0400485_07672 3300038735 Bacteria 8820
76 Ga0400488_28423 3300038741 Bacteria 4597
77 Ga0400486_18075 3300038742 Bacteria 41243
78 Ga0400489_44610 3300039093 Bacteria 146572
79 Ga0436365_0766036 3300039437 Bacteria 2450
80 Ga0436360_0463280 3300039438 Bacteria 1017
81 Ga0439438_010493 3300041405 Bacteria 2927
82 Ga0451807_1781159 3300041486 Bacteria 1438
83 Ga0453683_0133057 3300044673 Bacteria 1568
84 Ga0451576_0058095 3300045051 Bacteria 4043
85 Ga0495580_0082292 3300046472 Bacteria 2244
86 Ga0495628_0099848 3300046516 Bacteria 2241
87 Ga0495628_0244731 3300046516 Bacteria 1341
88 Ga0495630_0002940 3300046517 Bacteria 11843
89 Ga0495666_0062737 3300046526 Bacteria 1775
90 Ga0495665_0057120 3300046531 Bacteria 2060
91 Ga0495586_0073069 3300046535 Bacteria 1876
92 Ga0495635_0118363 3300046663 Bacteria 1808
93 Ga0495658_0136033 3300046683 Bacteria 1499
94 Ga0495613_0117595 3300046689 Bacteria 1911
95 Ga0495624_0067994 3300046690 Bacteria 2221
96 Ga0495581_0034657 3300047315 Bacteria 2920
97 Ga0495581_0163905 3300047315 Bacteria 1300
98 Ga0495674_0006235 3300047319 Bacteria 11441
99 Ga0495674_0125050 3300047319 Bacteria 2171
100 Ga0495676_0185396 3300047321 Bacteria 1455
101 Ga0495676_0207629 3300047321 Bacteria 1357
102 Ga0495675_0058493 3300047444 Bacteria 2444
103 Ga0495684_0006092 3300047471 Bacteria 9380
104 Ga0495614_0086774 3300048089 Bacteria 1359
105 Ga0496102_0023516 3300048905 Bacteria 5475
106 Ga0496102_0368308 3300048905 Bacteria 1352
107 Ga0496104_0004142 3300048907 Bacteria 12588
108 Ga0496104_0013919 3300048907 Bacteria 7259
109 Ga0496104_0021677 3300048907 Bacteria 5900
110 Ga0496105_0000832 3300048908 Bacteria 20983
111 Ga0496105_0032914 3300048908 Bacteria 4255
112 Ga0496108_0000812 3300048911 Bacteria 24256
113 Ga0496108_0042797 3300048911 Bacteria 3782
114 Ga0496109_0001448 3300048912 Bacteria 19658
115 Ga0496109_0023212 3300048912 Bacteria 5504
116 Ga0496109_0025829 3300048912 Bacteria 5235
117 Ga0496110_0028649 3300048913 Bacteria 4785
118 Ga0496110_0076288 3300048913 Bacteria 2980
119 Ga0496111_0000028 3300048914 Bacteria 58695
120 Ga0496112_0127770 3300048915 Bacteria 2513
121 Ga0496113_0041095 3300048916 Bacteria 3410
122 Ga0496114_0083597 3300048917 Bacteria 2701
123 Ga0496114_0122222 3300048917 Bacteria 2240
124 Ga0496115_0014181 3300048918 Bacteria 6031
125 Ga0496116_0183905 3300048919 Bacteria 1115
126 Ga0501031_0045977 3300049568 Bacteria 2848
127 Ga0501032_0000970 3300049569 Bacteria 23236
128 Ga0501034_0087489 3300049571 Bacteria 3115
129 Ga0501036_0007578 3300049572 Bacteria 8859
130 Ga0501036_0141785 3300049572 Bacteria 2028
131 Ga0501036_0402783 3300049572 Bacteria 1141
132 Ga0501037_0096643 3300049573 Bacteria 2135
133 Ga0501039_0297409 3300049575 Bacteria 1269
134 Ga0501040_0018086 3300049576 Bacteria 4681
135 Ga0501041_0272602 3300049577 Bacteria 1064
136 Ga0501043_0032807 3300049579 Bacteria 4084
137 Ga0501048_0009835 3300049582 Bacteria 7171
138 Ga0501048_0297852 3300049582 Bacteria 1147
139 Ga0501069_0018617 3300049585 Bacteria 3749
140 Ga0501071_0020034 3300049587 Bacteria 4647
141 Ga0501071_0068263 3300049587 Bacteria 2587
142 Ga0501072_0044158 3300049588 Bacteria 3505
143 Ga0501072_0218627 3300049588 Bacteria 1518
144 Ga0501074_0035651 3300049590 Bacteria 3604
145 Ga0501079_0027195 3300049741 Bacteria 4385
146 Ga0501079_0029109 3300049741 Bacteria 4240
147 Ga0501080_0061675 3300049742 Bacteria 3490
148 Ga0501080_0185860 3300049742 Bacteria 1911
149 Ga0501081_0027028 3300049743 Bacteria 3872
150 Ga0501083_0040372 3300049744 Bacteria 3168
151 Ga0501035_0144049 3300049822 Bacteria 2070
152 Ga0501045_0087666 3300049824 Bacteria 2298
153 Ga0501045_0172045 3300049824 Bacteria 1613
154 nmdc:mga06r32_353195_c1 3300050510 Bacteria 1454
155 nmdc:mga06r32_518100_c1 3300050510 Bacteria 1168
156 nmdc:mga0n895_43749_c1 3300050512 Bacteria 4365
157 nmdc:mga08x19_107140_c1 3300050514 Bacteria 1860
158 nmdc:mga0a205_153918_c1 3300050515 Bacteria 2198
159 Ga0495601_0000393 3300053077 Bacteria 23161
160 Ga0495601_0341427 3300053077 Bacteria 974
161 Ga0495595_0031583 3300053084 Bacteria 2381
162 Ga0495595_0076904 3300053084 Bacteria 1585
163 Ga0495619_0034393 3300053085 Bacteria 3295
164 Ga0501084_0004799 3300054114 Bacteria 11053
165 Ga0501084_0206776 3300054114 Bacteria 1656
166 Ga0501082_0017094 3300060353 Bacteria 6250
167 Ga0501082_0091923 3300060353 Bacteria 2620
168 Ga0530510_0048102 3300061734 Bacteria 3082
169 Ga0530510_0070213 3300061734 Bacteria 2542
170 2673163881 2671180531 Bacteria 9045424
171 Ga0436364_0933080
172 Ga0055541_1002089
173 Ga0070675_100058778
174 Ga0070675_100077792
175 Ga0070674_100026907
176 Ga0070714_100218625
177 Ga0070713_100053612
178 Ga0070708_100017539
179 Ga0070706_100008007
180 Ga0070706_100013839
181 Ga0070706_100015536
182 Ga0070707_100002513
183 Ga0070698_100078884
184 Ga0070698_100119243
185 Ga0070698_100266119
186 Ga0070697_100033826
187 Ga0070697_100118588
188 Ga0070665_100000153
189 Ga0068857_100009267
190 Ga0081539_10008049
191 Ga0070717_10003971
192 Ga0070717_10041683
193 Ga0070717_10091677
194 Ga0070717_10234625
195 Ga0070712_100183178
196 Ga0075428_100000289
197 Ga0075428_100034747
198 Ga0075430_100006159
199 Ga0075433_10060413
200 Ga0075434_100527856
201 Ga0105241_10168058
202 Ga0105242_10411059
203 Ga0105248_10568744
204 Ga0157371_10212041
205 Ga0157369_10090284
206 Ga0157369_10379690
207 Ga0163162_10166928
208 Ga0157372_10224563
209 Ga0157372_10405059
210 Ga0157372_10423906
211 Ga0157375_10439020
212 Ga0157375_10878418
213 Ga0157380_10130140
214 Ga0157376_10332348
215 Ga0213876_10062350
216 Ga0207684_10004816
217 Ga0207684_10051617
218 Ga0207654_10252271
219 Ga0207695_10000845
220 Ga0207646_10000325
221 Ga0207646_10027190
222 Ga0207659_10062106
223 Ga0207659_10192876
224 Ga0207687_10096587
225 Ga0207700_10046320
226 Ga0207664_10047152
227 Ga0207664_10056234
228 Ga0207664_10186291
229 Ga0207686_10103661
230 Ga0207691_10049643
231 Ga0207689_10593544
232 Ga0207651_10037724
233 Ga0207703_10181847
234 Ga0207674_10000506
235 Ga0268266_10001100
236 Ga0268265_10468937
237 Ga0316577_10028747
238 Ga0307407_10125157
239 Ga0307409_100015873
240 Ga0307409_100308237
241 Ga0316584_0091732
242 Ga0316584_0104691
243 Ga0395901_0018199
244 Ga0395901_0304258
245 Ga0400485_07672
246 Ga0400488_28423
247 Ga0400486_18075
248 Ga0400489_44610
249 Ga0436365_0766036
250 Ga0436360_0463280
251 Ga0439438_010493
252 Ga0451807_1781159
253 Ga0453683_0133057
254 Ga0451576_0058095
255 Ga0495580_0082292
256 Ga0495628_0099848
257 Ga0495628_0244731
258 Ga0495630_0002940
259 Ga0495666_0062737
260 Ga0495665_0057120
261 Ga0495586_0073069
262 Ga0495635_0118363
263 Ga0495658_0136033
264 Ga0495613_0117595
265 Ga0495624_0067994
266 Ga0495581_0034657
267 Ga0495581_0163905
268 Ga0495674_0006235
269 Ga0495674_0125050
270 Ga0495676_0185396
271 Ga0495676_0207629
272 Ga0495675_0058493
273 Ga0495684_0006092
274 Ga0495614_0086774
275 Ga0496102_0023516
276 Ga0496102_0368308
277 Ga0496104_0004142
278 Ga0496104_0013919
279 Ga0496104_0021677
280 Ga0496105_0000832
281 Ga0496105_0032914
282 Ga0496108_0000812
283 Ga0496108_0042797
284 Ga0496109_0001448
285 Ga0496109_0023212
286 Ga0496109_0025829
287 Ga0496110_0028649
288 Ga0496110_0076288
289 Ga0496111_0000028
290 Ga0496112_0127770
291 Ga0496113_0041095
292 Ga0496114_0083597
293 Ga0496114_0122222
294 Ga0496115_0014181
295 Ga0496116_0183905
296 Ga0501031_0045977
297 Ga0501032_0000970
298 Ga0501034_0087489
299 Ga0501036_0007578
300 Ga0501036_0141785
301 Ga0501036_0402783
302 Ga0501037_0096643
303 Ga0501039_0297409
304 Ga0501040_0018086
305 Ga0501041_0272602
306 Ga0501043_0032807
307 Ga0501048_0009835
308 Ga0501048_0297852
309 Ga0501069_0018617
310 Ga0501071_0020034
311 Ga0501071_0068263
312 Ga0501072_0044158
313 Ga0501072_0218627
314 Ga0501074_0035651
315 Ga0501079_0027195
316 Ga0501079_0029109
317 Ga0501080_0061675
318 Ga0501080_0185860
319 Ga0501081_0027028
320 Ga0501083_0040372
321 Ga0501035_0144049
322 Ga0501045_0087666
323 Ga0501045_0172045
324 nmdc:mga06r32_353195_c1
325 nmdc:mga06r32_518100_c1
326 nmdc:mga0n895_43749_c1
327 nmdc:mga08x19_107140_c1
328 nmdc:mga0a205_153918_c1
329 Ga0495601_0000393
330 Ga0495601_0341427
331 Ga0495595_0031583
332 Ga0495595_0076904
333 Ga0495619_0034393
334 Ga0501084_0004799
335 Ga0501084_0206776
336 Ga0501082_0017094
337 Ga0501082_0091923
338 Ga0530510_0048102
339 Ga0530510_0070213
340 2673163881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01259

SAICAR_synt

SAICAR synthetase

33

286

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1obd-assembly1.cif.gz_A saicar-synthase complexed with atp 0.913 7 292
6yya-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor 0.9091 15 292
2cnq-assembly1.cif.gz_A atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate 0.9087 3 297
6yyb-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor 0.908 15 292
6z0r-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with fragment 1 0.9076 15 292
ID Description Score Start End Superfamily
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9559 107 248 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9521 107 248 3.30.470.20
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9304 107 248 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9207 107 248 3.30.470.20
af_P38025_185_330_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8921 109 241 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A358GC57-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9945 5 293 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A7Z2ZLY3-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9937 1 293 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A4R6MW62-F1-model_v4 deleted 0.9932 5 294
AF-A0A2Z2KH79-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.993 1 292 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-E0IAH2-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9926 3 292 GO:0004639
GO:0005524
GO:0005737
GO:0006189

Map