F257073

General Info

Members Datasets Scaffolds Average Seq Length
170 105 340 128

Family's Representative Sequence

Representative Sequence 3300031733|Ga0316577_10435055|Ga0316577_104350551
Length 142
Sequence MPPTRLKEETMKEIDALKFPGDVRYSRDHEWARKDGDVFTVGISDFAQDQMGDVVFVELPETGRTFDKGQEFGTVESVKAVSELFMPVAGEVVEVNAGLEDGPEHINNDPYGEGWMIKVRTASPGDFDELMDRETYLAHVKG

Samples

Sample ID Description Type Environment
1 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
50 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
55 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
60 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
61 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
62 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
64 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
67 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
68 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
69 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
70 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
71 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
72 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
73 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
74 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
75 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
76 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
77 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
92 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
93 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
94 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
95 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
96 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
100 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
101 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
102 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
103 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
104 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
105 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 1.76
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0
Rhizoplane 3.53
Rhizosphere 87.65
Stem 0
Stem Tuber 0
Unclassified 6.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316577_10435055 3300031733 Bacteria 745
2 JGI25405J52794_10011579 3300003911 Bacteria 1689
3 Ga0070680_100449802 3300005336 Bacteria 1100
4 Ga0070691_10093156 3300005341 Bacteria 1488
5 Ga0070692_10000744 3300005345 Bacteria 10611
6 Ga0070675_100930852 3300005354 Bacteria 797
7 Ga0070703_10058202 3300005406 Bacteria 1257
8 Ga0070711_100265342 3300005439 Bacteria 1353
9 Ga0070700_100228933 3300005441 Bacteria 1322
10 Ga0070694_100005048 3300005444 Bacteria 7964
11 Ga0070694_100022038 3300005444 Bacteria 4079
12 Ga0070662_101452679 3300005457 Bacteria 591
13 Ga0070706_100018095 3300005467 Bacteria 6500
14 Ga0070707_100000542 3300005468 Bacteria 37745
15 Ga0070698_100011933 3300005471 Bacteria 9220
16 Ga0070699_100668991 3300005518 Bacteria 948
17 Ga0070697_100000314 3300005536 Bacteria 38406
18 Ga0070697_100361349 3300005536 Bacteria 1255
19 Ga0070696_100401119 3300005546 Bacteria 1073
20 Ga0070696_100549714 3300005546 Bacteria 925
21 Ga0070704_100001356 3300005549 Bacteria 12986
22 Ga0070704_100941833 3300005549 Bacteria 779
23 Ga0068859_100000008 3300005617 Bacteria 383750
24 Ga0068861_100023501 3300005719 Bacteria 4446
25 Ga0068860_100951968 3300005843 Bacteria 876
26 Ga0068862_100415351 3300005844 Bacteria 1261
27 Ga0081455_10000666 3300005937 Bacteria 44517
28 Ga0075428_100003610 3300006844 Bacteria 16960
29 Ga0075433_10514403 3300006852 Bacteria 1053
30 Ga0075436_100179480 3300006914 Bacteria 1496
31 Ga0097620_100000008 3300006931 Bacteria 383750
32 Ga0097620_100887439 3300006931 Bacteria 977
33 Ga0111539_10137456 3300009094 Bacteria 2861
34 Ga0105242_10661142 3300009176 Bacteria 1017
35 Ga0105248_10442448 3300009177 Bacteria 1464
36 Ga0105249_11813371 3300009553 Bacteria 683
37 Ga0157378_10838917 3300013297 Bacteria 947
38 Ga0157380_10024827 3300014326 Bacteria 4540
39 Ga0157380_12501653 3300014326 Unclassified 582
40 Ga0207684_10020677 3300025910 Bacteria 5623
41 Ga0207660_10416141 3300025917 Bacteria 1084
42 Ga0207660_11174787 3300025917 Bacteria 625
43 Ga0207646_10000019 3300025922 Bacteria 282855
44 Ga0207706_11178529 3300025933 Bacteria 637
45 Ga0207686_10591875 3300025934 Bacteria 872
46 Ga0207704_10349749 3300025938 Bacteria 1150
47 Ga0207711_10754505 3300025941 Bacteria 907
48 Ga0207689_11445965 3300025942 Unclassified 575
49 Ga0207712_10872402 3300025961 Bacteria 794
50 Ga0207703_11971290 3300026035 Bacteria 560
51 Ga0207708_10215283 3300026075 Bacteria 1537
52 Ga0207675_100038362 3300026118 Bacteria 4470
53 Ga0209971_1011377 3300027682 Bacteria 2108
54 Ga0268265_10371004 3300028380 Bacteria 1313
55 Ga0268264_10246086 3300028381 Bacteria 1659
56 Ga0265332_10480133 3300031238 Bacteria 515
57 Ga0265328_10122414 3300031239 Bacteria 971
58 Ga0265327_10002814 3300031251 Bacteria 17561
59 Ga0265316_10421745 3300031344 Bacteria 959
60 Ga0307408_101630318 3300031548 Bacteria 613
61 Ga0316575_10026637 3300031665 Bacteria 2247
62 Ga0316579_10011060 3300031691 Bacteria 3829
63 Ga0316579_10012535 3300031691 Bacteria 3630
64 Ga0316579_10017825 3300031691 Bacteria 3119
65 Ga0316579_10445481 3300031691 Unclassified 626
66 Ga0316576_10001094 3300031727 Bacteria 14122
67 Ga0316576_10016539 3300031727 Bacteria 4985
68 Ga0316576_10075823 3300031727 Bacteria 2488
69 Ga0316576_10311638 3300031727 Bacteria 1175
70 Ga0316576_10637199 3300031727 Bacteria 776
71 Ga0316578_10002076 3300031728 Bacteria 8569
72 Ga0316578_10041365 3300031728 Bacteria 2668
73 Ga0316578_10118143 3300031728 Bacteria 1593
74 Ga0316578_10230031 3300031728 Unclassified 1114
75 Ga0316578_10389581 3300031728 Bacteria 826
76 Ga0316577_10001430 3300031733 Bacteria 11292
77 Ga0316577_10007246 3300031733 Bacteria 5914
78 Ga0316577_10038481 3300031733 Bacteria 2675
79 Ga0307416_100764190 3300032002 Bacteria 1060
80 Ga0316583_10000012 3300032133 Bacteria 36422
81 Ga0316583_10036121 3300032133 Bacteria 1753
82 Ga0316583_10069179 3300032133 Bacteria 1235
83 Ga0316585_10102728 3300032137 Bacteria 938
84 Ga0316580_10021776 3300032139 Unclassified 1977
85 Ga0316593_10002136 3300032168 Bacteria 4604
86 Ga0316593_10201007 3300032168 Bacteria 737
87 Ga0373951_0045144 3300035091 Bacteria 1071
88 Ga0316574_0008454 3300035398 Bacteria 5718
89 Ga0316574_0063529 3300035398 Bacteria 2322
90 Ga0316574_0081815 3300035398 Bacteria 2051
91 Ga0316574_0230260 3300035398 Bacteria 1186
92 Ga0316574_0532108 3300035398 Unclassified 731
93 Ga0373937_1771755 3300036401 Bacteria 564
94 Ga0316582_0007278 3300036647 Bacteria 5886
95 Ga0316582_0034053 3300036647 Bacteria 3134
96 Ga0316582_0043785 3300036647 Bacteria 2810
97 Ga0316582_0055147 3300036647 Bacteria 2532
98 Ga0316582_0073084 3300036647 Bacteria 2225
99 Ga0316582_0082181 3300036647 Bacteria 2105
100 Ga0316584_0001107 3300036712 Bacteria 15773
101 Ga0316584_0010223 3300036712 Bacteria 6552
102 Ga0316584_0036035 3300036712 Bacteria 3671
103 Ga0316584_0067964 3300036712 Bacteria 2670
104 Ga0316584_0120031 3300036712 Unclassified 1965
105 Ga0316584_0124287 3300036712 Bacteria 1927
106 Ga0316584_0976758 3300036712 Bacteria 567
107 Ga0316581_0007014 3300037588 Bacteria 3004
108 Ga0316581_0012655 3300037588 Unclassified 2378
109 Ga0316581_0019491 3300037588 Bacteria 1979
110 Ga0316581_0201134 3300037588 Bacteria 613
111 Ga0400484_30947 3300038725 Bacteria 4097
112 Ga0400490_42397 3300038726 Bacteria 53524
113 Ga0400491_18553 3300038727 Bacteria 1016
114 Ga0400489_94802 3300039093 Bacteria 42634
115 Ga0451795_0692196 3300041456 Bacteria 564
116 Ga0451795_0831438 3300041456 Bacteria 1317
117 Ga0451795_0865837 3300041456 Bacteria 589
118 Ga0451795_0976162 3300041456 Bacteria 746
119 Ga0451795_1381188 3300041456 Bacteria 2369
120 Ga0451837_0810754 3300041494 Unclassified 560
121 Ga0451837_1470451 3300041494 Unclassified 677
122 Ga0451852_28159 3300041508 Bacteria 671
123 Ga0451855_0840906 3300041511 Bacteria 1377
124 Ga0451855_1724370 3300041511 Bacteria 532
125 Ga0451855_1985235 3300041511 Bacteria 3044
126 Ga0451855_2013094 3300041511 Bacteria 1639
127 Ga0451853_2218622 3300041512 Bacteria 763
128 Ga0451577_0009136 3300042876 Bacteria 9565
129 Ga0451577_0064966 3300042876 Bacteria 3254
130 Ga0451577_0270404 3300042876 Bacteria 1539
131 Ga0453683_0059459 3300044673 Bacteria 2389
132 Ga0453683_0270671 3300044673 Bacteria 1084
133 Ga0453683_0577194 3300044673 Bacteria 732
134 Ga0453683_0848410 3300044673 Bacteria 603
135 Ga0453684_0010930 3300044712 Bacteria 15357
136 Ga0453684_0071836 3300044712 Bacteria 4372
137 Ga0453684_0083465 3300044712 Bacteria 3976
138 Ga0453684_0284030 3300044712 Bacteria 1886
139 Ga0453684_0462791 3300044712 Bacteria 1410
140 Ga0453684_1301868 3300044712 Bacteria 758
141 Ga0451576_0005384 3300045051 Bacteria 16086
142 Ga0451576_0033413 3300045051 Bacteria 5467
143 Ga0451576_0457241 3300045051 Bacteria 1340
144 Ga0451576_1087268 3300045051 Bacteria 837
145 Ga0495592_0568656 3300046454 Bacteria 695
146 Ga0495628_0024256 3300046516 Bacteria 4967
147 Ga0495604_0353383 3300047317 Bacteria 976
148 Ga0496109_0758675 3300048912 Bacteria 908
149 Ga0501036_0033691 3300049572 Bacteria 4331
150 Ga0501039_0258028 3300049575 Bacteria 1370
151 Ga0501040_0176120 3300049576 Bacteria 1515
152 Ga0501042_0063352 3300049578 Bacteria 2642
153 Ga0501048_0035659 3300049582 Bacteria 3580
154 Ga0501071_0026262 3300049587 Bacteria 4086
155 Ga0501072_0253170 3300049588 Bacteria 1402
156 Ga0501073_0125613 3300049589 Bacteria 1778
157 Ga0501075_0073624 3300049591 Bacteria 2583
158 Ga0501076_0012372 3300049592 Bacteria 6380
159 Ga0501076_0886342 3300049592 Bacteria 736
160 Ga0501080_0318127 3300049742 Bacteria 1409
161 Ga0501035_0353862 3300049822 Bacteria 1228
162 nmdc:mga09592_1209728_c1 3300050508 Bacteria 624
163 nmdc:mga08y16_410082_c1 3300050511 Bacteria 1386
164 nmdc:mga08x19_353084_c1 3300050514 Unclassified 1027
165 Ga0500554_201719 3300053102 Bacteria 665
166 Ga0500628_009082 3300053129 Bacteria 1743
167 Ga0501084_0272994 3300054114 Bacteria 1428
168 Ga0501084_1186162 3300054114 Bacteria 640
169 Ga0501082_0368424 3300060353 Bacteria 1253
170 2645719721 2643221961 Bacteria 3919167
171 Ga0316577_10435055
172 JGI25405J52794_10011579
173 Ga0070680_100449802
174 Ga0070691_10093156
175 Ga0070692_10000744
176 Ga0070675_100930852
177 Ga0070703_10058202
178 Ga0070711_100265342
179 Ga0070700_100228933
180 Ga0070694_100005048
181 Ga0070694_100022038
182 Ga0070662_101452679
183 Ga0070706_100018095
184 Ga0070707_100000542
185 Ga0070698_100011933
186 Ga0070699_100668991
187 Ga0070697_100000314
188 Ga0070697_100361349
189 Ga0070696_100401119
190 Ga0070696_100549714
191 Ga0070704_100001356
192 Ga0070704_100941833
193 Ga0068859_100000008
194 Ga0068861_100023501
195 Ga0068860_100951968
196 Ga0068862_100415351
197 Ga0081455_10000666
198 Ga0075428_100003610
199 Ga0075433_10514403
200 Ga0075436_100179480
201 Ga0097620_100000008
202 Ga0097620_100887439
203 Ga0111539_10137456
204 Ga0105242_10661142
205 Ga0105248_10442448
206 Ga0105249_11813371
207 Ga0157378_10838917
208 Ga0157380_10024827
209 Ga0157380_12501653
210 Ga0207684_10020677
211 Ga0207660_10416141
212 Ga0207660_11174787
213 Ga0207646_10000019
214 Ga0207706_11178529
215 Ga0207686_10591875
216 Ga0207704_10349749
217 Ga0207711_10754505
218 Ga0207689_11445965
219 Ga0207712_10872402
220 Ga0207703_11971290
221 Ga0207708_10215283
222 Ga0207675_100038362
223 Ga0209971_1011377
224 Ga0268265_10371004
225 Ga0268264_10246086
226 Ga0265332_10480133
227 Ga0265328_10122414
228 Ga0265327_10002814
229 Ga0265316_10421745
230 Ga0307408_101630318
231 Ga0316575_10026637
232 Ga0316579_10011060
233 Ga0316579_10012535
234 Ga0316579_10017825
235 Ga0316579_10445481
236 Ga0316576_10001094
237 Ga0316576_10016539
238 Ga0316576_10075823
239 Ga0316576_10311638
240 Ga0316576_10637199
241 Ga0316578_10002076
242 Ga0316578_10041365
243 Ga0316578_10118143
244 Ga0316578_10230031
245 Ga0316578_10389581
246 Ga0316577_10001430
247 Ga0316577_10007246
248 Ga0316577_10038481
249 Ga0307416_100764190
250 Ga0316583_10000012
251 Ga0316583_10036121
252 Ga0316583_10069179
253 Ga0316585_10102728
254 Ga0316580_10021776
255 Ga0316593_10002136
256 Ga0316593_10201007
257 Ga0373951_0045144
258 Ga0316574_0008454
259 Ga0316574_0063529
260 Ga0316574_0081815
261 Ga0316574_0230260
262 Ga0316574_0532108
263 Ga0373937_1771755
264 Ga0316582_0007278
265 Ga0316582_0034053
266 Ga0316582_0043785
267 Ga0316582_0055147
268 Ga0316582_0073084
269 Ga0316582_0082181
270 Ga0316584_0001107
271 Ga0316584_0010223
272 Ga0316584_0036035
273 Ga0316584_0067964
274 Ga0316584_0120031
275 Ga0316584_0124287
276 Ga0316584_0976758
277 Ga0316581_0007014
278 Ga0316581_0012655
279 Ga0316581_0019491
280 Ga0316581_0201134
281 Ga0400484_30947
282 Ga0400490_42397
283 Ga0400491_18553
284 Ga0400489_94802
285 Ga0451795_0692196
286 Ga0451795_0831438
287 Ga0451795_0865837
288 Ga0451795_0976162
289 Ga0451795_1381188
290 Ga0451837_0810754
291 Ga0451837_1470451
292 Ga0451852_28159
293 Ga0451855_0840906
294 Ga0451855_1724370
295 Ga0451855_1985235
296 Ga0451855_2013094
297 Ga0451853_2218622
298 Ga0451577_0009136
299 Ga0451577_0064966
300 Ga0451577_0270404
301 Ga0453683_0059459
302 Ga0453683_0270671
303 Ga0453683_0577194
304 Ga0453683_0848410
305 Ga0453684_0010930
306 Ga0453684_0071836
307 Ga0453684_0083465
308 Ga0453684_0284030
309 Ga0453684_0462791
310 Ga0453684_1301868
311 Ga0451576_0005384
312 Ga0451576_0033413
313 Ga0451576_0457241
314 Ga0451576_1087268
315 Ga0495592_0568656
316 Ga0495628_0024256
317 Ga0495604_0353383
318 Ga0496109_0758675
319 Ga0501036_0033691
320 Ga0501039_0258028
321 Ga0501040_0176120
322 Ga0501042_0063352
323 Ga0501048_0035659
324 Ga0501071_0026262
325 Ga0501072_0253170
326 Ga0501073_0125613
327 Ga0501075_0073624
328 Ga0501076_0012372
329 Ga0501076_0886342
330 Ga0501080_0318127
331 Ga0501035_0353862
332 nmdc:mga09592_1209728_c1
333 nmdc:mga08y16_410082_c1
334 nmdc:mga08x19_353084_c1
335 Ga0500554_201719
336 Ga0500628_009082
337 Ga0501084_0272994
338 Ga0501084_1186162
339 Ga0501082_0368424
340 2645719721

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

23

142

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.986 8 126
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9843 8 130
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9719 3 130
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.97 3 128
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9666 3 127
ID Description Score Start End Superfamily
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9833 8 130 2.40.50.100
af_Q54JU3_2_142_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9754 8 125 2.40.50.100
af_K7TZ76_31_128_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.965 38 127 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9648 3 124 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9602 8 130 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A7S0R7I5-F1-model_v4 Glycine cleavage system H protein 1.001 2 127 GO:0005739
GO:0005960
GO:0019464
AF-A0A1V5KX49-F1-model_v4 Glycine cleavage system H protein 1 3 125 GO:0005829
GO:0005960
GO:0019464
AF-A0A6M1UBC4-F1-model_v4 Glycine cleavage system H protein (Octanoyl/lipoyl carrier protein) 1 5 126 GO:0005829
GO:0005960
GO:0019464
AF-A0A7C0V2E2-F1-model_v4 Glycine cleavage system H protein 0.9997 3 125 GO:0005829
GO:0005960
GO:0019464
AF-A0A1W9S5T1-F1-model_v4 Glycine cleavage system H protein 0.9997 4 127 GO:0005829
GO:0005960
GO:0019464

Map