F256414

General Info

Members Datasets Scaffolds Average Seq Length
170 129 340 161

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_101748465|Ga0068852_1017484651
Length 179
Sequence MVVMSEMEKHRLRSVPLQSEAMSDSRQFLRHTLATLAYRGGKAVRDAPPEFAAFKAGETSRTPAQILAHIGDLLDWMLSLAQGKQAWNNATPLPWDDEIARFHRCLGAMDDYLASSEPLHETPEKMFQGPVADAFTHVGQIAMLRRMSGAPMKGENYHRADIAEGRVGAEQAAPRREFD

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
68 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
69 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.24
Metatranscriptomes 1.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.12
Rhizosphere 95.88
Stem 0
Stem Tuber 0
Unclassified 34.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_101748465 3300005616 Bacteria 644
2 Ga0068869_100143143 3300005334 Bacteria 1848
3 Ga0070689_100390860 3300005340 Unclassified 1174
4 Ga0070689_100589497 3300005340 Unclassified 962
5 Ga0070687_100189912 3300005343 Bacteria 1237
6 Ga0070661_101885504 3300005344 Unclassified 508
7 Ga0070668_100046779 3300005347 Unclassified 3324
8 Ga0070688_100236994 3300005365 Bacteria 1293
9 Ga0070710_10992183 3300005437 Unclassified 611
10 Ga0070708_100229387 3300005445 Bacteria 1742
11 Ga0070663_101706649 3300005455 Bacteria 563
12 Ga0070678_100445143 3300005456 Bacteria 1134
13 Ga0070707_100527694 3300005468 Unclassified 1142
14 Ga0070707_101366095 3300005468 Unclassified 675
15 Ga0070698_100145299 3300005471 Bacteria 2322
16 Ga0070698_100377046 3300005471 Bacteria 1351
17 Ga0070698_100408798 3300005471 Bacteria 1291
18 Ga0070698_101051811 3300005471 Unclassified 762
19 Ga0070697_100282754 3300005536 Bacteria 1424
20 Ga0070697_100448218 3300005536 Unclassified 1124
21 Ga0070665_100111816 3300005548 Bacteria 2734
22 Ga0070704_100237610 3300005549 Bacteria 1490
23 Ga0070664_100064226 3300005564 Bacteria 3131
24 Ga0068854_100048196 3300005578 Bacteria 3039
25 Ga0068852_100819962 3300005616 Bacteria 945
26 Ga0068859_100706253 3300005617 Unclassified 1099
27 Ga0068859_101407380 3300005617 Unclassified 769
28 Ga0068863_100411927 3300005841 Unclassified 1323
29 Ga0068863_101022552 3300005841 Unclassified 829
30 Ga0068858_100998461 3300005842 Bacteria 820
31 Ga0081539_10012859 3300005985 Bacteria 6380
32 Ga0075428_101066204 3300006844 Unclassified 854
33 Ga0075430_100127131 3300006846 Unclassified 2125
34 Ga0075431_100322671 3300006847 Bacteria 1557
35 Ga0075429_100009881 3300006880 Bacteria 8273
36 Ga0075429_100288546 3300006880 Unclassified 1437
37 Ga0075429_101379262 3300006880 Unclassified 614
38 Ga0097620_100706247 3300006931 Unclassified 1099
39 Ga0097620_101407603 3300006931 Unclassified 769
40 Ga0099795_10455183 3300007788 Bacteria 590
41 Ga0111539_12102722 3300009094 Unclassified 655
42 Ga0105245_10062638 3300009098 Bacteria 3356
43 Ga0114129_10210364 3300009147 Bacteria 2630
44 Ga0105242_10278033 3300009176 Bacteria 1519
45 Ga0105248_10124221 3300009177 Bacteria 2911
46 Ga0105248_12237041 3300009177 Unclassified 622
47 Ga0105238_10005237 3300009551 Bacteria 12819
48 Ga0105249_10001086 3300009553 Bacteria 24172
49 Ga0105249_10344184 3300009553 Unclassified 1509
50 Ga0157370_10141491 3300013104 Bacteria 2242
51 Ga0157369_10221552 3300013105 Bacteria 1980
52 Ga0157372_11556266 3300013307 Bacteria 761
53 Ga0157375_12249365 3300013308 Unclassified 650
54 Ga0163163_10000054 3300014325 Bacteria 126041
55 Ga0157377_10000041 3300014745 Bacteria 110626
56 Ga0157379_10003423 3300014968 Bacteria 13421
57 Ga0224572_1025788 3300024225 Unclassified 1128
58 Ga0207685_10175018 3300025905 Bacteria 990
59 Ga0207699_10443506 3300025906 Unclassified 930
60 Ga0207671_10413459 3300025914 Bacteria 1073
61 Ga0207693_10754332 3300025915 Unclassified 752
62 Ga0207663_10269031 3300025916 Bacteria 1262
63 Ga0207662_10107527 3300025918 Bacteria 1736
64 Ga0207646_10746958 3300025922 Unclassified 873
65 Ga0207646_11084418 3300025922 Unclassified 705
66 Ga0207694_10035029 3300025924 Bacteria 3850
67 Ga0207650_10003018 3300025925 Bacteria 11599
68 Ga0207670_10390526 3300025936 Unclassified 1110
69 Ga0207665_10156418 3300025939 Bacteria 1636
70 Ga0207691_11185291 3300025940 Unclassified 634
71 Ga0207711_10076726 3300025941 Bacteria 2911
72 Ga0207689_10153805 3300025942 Bacteria 1896
73 Ga0207679_10057910 3300025945 Bacteria 2868
74 Ga0207712_10000233 3300025961 Bacteria 54527
75 Ga0207668_10034588 3300025972 Bacteria 3357
76 Ga0207640_10847284 3300025981 Unclassified 795
77 Ga0207703_11944061 3300026035 Bacteria 564
78 Ga0207678_10129613 3300026067 Bacteria 2151
79 Ga0207702_10038730 3300026078 Bacteria 3993
80 Ga0207641_10285001 3300026088 Bacteria 1555
81 Ga0207641_10751005 3300026088 Unclassified 963
82 Ga0207641_11243057 3300026088 Bacteria 745
83 Ga0265760_10004113 3300031090 Unclassified 4189
84 Ga0265760_10016325 3300031090 Unclassified 2130
85 Ga0265760_10027275 3300031090 Bacteria 1673
86 Ga0265330_10002564 3300031235 Bacteria 9866
87 Ga0265330_10007705 3300031235 Bacteria 5230
88 Ga0265330_10021332 3300031235 Bacteria 2958
89 Ga0265332_10041214 3300031238 Bacteria 1998
90 Ga0265328_10006526 3300031239 Bacteria 4922
91 Ga0265328_10053673 3300031239 Unclassified 1479
92 Ga0265325_10082729 3300031241 Bacteria 1593
93 Ga0265329_10200031 3300031242 Archaea 657
94 Ga0265339_10167494 3300031249 Unclassified 1102
95 Ga0265331_10160917 3300031250 Unclassified 1017
96 Ga0265331_10345672 3300031250 Unclassified 666
97 Ga0265316_10020818 3300031344 Bacteria 5571
98 Ga0265316_10059316 3300031344 Bacteria 2976
99 Ga0265313_10029637 3300031595 Bacteria 2828
100 Ga0265342_10018216 3300031712 Bacteria 4554
101 Ga0265342_10060365 3300031712 Bacteria 2236
102 Ga0373943_0238939 3300035170 Unclassified 1017
103 Ga0373931_0511429 3300035691 Unclassified 776
104 Ga0373927_0013538 3300035695 Bacteria 5418
105 Ga0373933_0448188 3300035724 Unclassified 844
106 Ga0373937_0264947 3300036401 Bacteria 1621
107 Ga0373937_0830005 3300036401 Unclassified 872
108 Ga0451577_0317573 3300042876 Bacteria 1412
109 Ga0451577_0620182 3300042876 Bacteria 981
110 Ga0451577_1130859 3300042876 Unclassified 700
111 Ga0453684_0044371 3300044712 Bacteria 5951
112 Ga0466960_0074139 3300044901 Bacteria 1700
113 Ga0451576_0064318 3300045051 Bacteria 3821
114 Ga0451576_0358719 3300045051 Bacteria 1526
115 Ga0451576_0638784 3300045051 Unclassified 1118
116 Ga0451576_0975000 3300045051 Bacteria 889
117 Ga0451576_1183775 3300045051 Unclassified 798
118 Ga0466967_0185392 3300045976 Bacteria 1965
119 Ga0495592_0080971 3300046454 Bacteria 2348
120 Ga0495603_0260782 3300046455 Bacteria 997
121 Ga0495629_0063319 3300046459 Bacteria 2583
122 Ga0495629_0314893 3300046459 Bacteria 1070
123 Ga0495641_0021851 3300046461 Bacteria 3212
124 Ga0495580_0000936 3300046472 Bacteria 25491
125 Ga0495582_0008217 3300046473 Bacteria 5759
126 Ga0495662_0257367 3300046476 Unclassified 859
127 Ga0495664_0009809 3300046477 Bacteria 5368
128 Ga0495594_0011351 3300046499 Bacteria 4628
129 Ga0495608_0245279 3300046511 Unclassified 1118
130 Ga0495618_0010874 3300046514 Bacteria 5510
131 Ga0495628_0353737 3300046516 Bacteria 1079
132 Ga0495630_0038346 3300046517 Bacteria 3584
133 Ga0495630_0534447 3300046517 Unclassified 899
134 Ga0495666_0000718 3300046526 Bacteria 15134
135 Ga0495665_0015657 3300046531 Bacteria 4083
136 Ga0495640_0021222 3300046533 Bacteria 4770
137 Ga0495586_0001373 3300046535 Bacteria 13519
138 Ga0495586_0573823 3300046535 Unclassified 651
139 Ga0495667_0541816 3300046559 Bacteria 727
140 Ga0495634_0025955 3300046642 Bacteria 4092
141 Ga0495647_0003787 3300046681 Bacteria 4865
142 Ga0495658_0024390 3300046683 Bacteria 3221
143 Ga0495658_0481035 3300046683 Bacteria 794
144 Ga0495669_0003862 3300046684 Bacteria 6163
145 Ga0495613_0046976 3300046689 Bacteria 3190
146 Ga0495624_0035603 3300046690 Unclassified 3214
147 Ga0495600_0036283 3300046809 Bacteria 3204
148 Ga0495600_0058215 3300046809 Bacteria 2524
149 Ga0495674_0025982 3300047319 Bacteria 5359
150 Ga0495676_0253621 3300047321 Bacteria 1199
151 Ga0495680_0137754 3300047322 Bacteria 1788
152 Ga0495680_0324240 3300047322 Bacteria 1077
153 Ga0495684_0022566 3300047471 Bacteria 4840
154 Ga0495684_0633582 3300047471 Unclassified 717
155 Ga0496106_0164172 3300048909 Bacteria 1757
156 Ga0496107_0421272 3300048910 Unclassified 993
157 Ga0496109_0448432 3300048912 Unclassified 1219
158 Ga0496111_0355768 3300048914 Bacteria 1084
159 Ga0496112_0071619 3300048915 Unclassified 3426
160 Ga0496112_0309834 3300048915 Bacteria 1524
161 Ga0496114_0547232 3300048917 Unclassified 1023
162 Ga0501075_0681698 3300049591 Unclassified 783
163 nmdc:mga05p37_1789840_c1 3300050507 Bacteria 593
164 nmdc:mga09592_1010424_c1 3300050508 Bacteria 695
165 nmdc:mga09592_9559_c1 3300050508 Bacteria 7879
166 nmdc:mga0qj67_675389_c1 3300050509 Unclassified 823
167 nmdc:mga06r32_1469936_c1 3300050510 Bacteria 622
168 nmdc:mga0rr50_550728_c1 3300050513 Unclassified 982
169 nmdc:mga0a205_771025_c1 3300050515 Bacteria 810
170 Ga0495601_0984443 3300053077 Bacteria 531
171 Ga0068852_101748465
172 Ga0068869_100143143
173 Ga0070689_100390860
174 Ga0070689_100589497
175 Ga0070687_100189912
176 Ga0070661_101885504
177 Ga0070668_100046779
178 Ga0070688_100236994
179 Ga0070710_10992183
180 Ga0070708_100229387
181 Ga0070663_101706649
182 Ga0070678_100445143
183 Ga0070707_100527694
184 Ga0070707_101366095
185 Ga0070698_100145299
186 Ga0070698_100377046
187 Ga0070698_100408798
188 Ga0070698_101051811
189 Ga0070697_100282754
190 Ga0070697_100448218
191 Ga0070665_100111816
192 Ga0070704_100237610
193 Ga0070664_100064226
194 Ga0068854_100048196
195 Ga0068852_100819962
196 Ga0068859_100706253
197 Ga0068859_101407380
198 Ga0068863_100411927
199 Ga0068863_101022552
200 Ga0068858_100998461
201 Ga0081539_10012859
202 Ga0075428_101066204
203 Ga0075430_100127131
204 Ga0075431_100322671
205 Ga0075429_100009881
206 Ga0075429_100288546
207 Ga0075429_101379262
208 Ga0097620_100706247
209 Ga0097620_101407603
210 Ga0099795_10455183
211 Ga0111539_12102722
212 Ga0105245_10062638
213 Ga0114129_10210364
214 Ga0105242_10278033
215 Ga0105248_10124221
216 Ga0105248_12237041
217 Ga0105238_10005237
218 Ga0105249_10001086
219 Ga0105249_10344184
220 Ga0157370_10141491
221 Ga0157369_10221552
222 Ga0157372_11556266
223 Ga0157375_12249365
224 Ga0163163_10000054
225 Ga0157377_10000041
226 Ga0157379_10003423
227 Ga0224572_1025788
228 Ga0207685_10175018
229 Ga0207699_10443506
230 Ga0207671_10413459
231 Ga0207693_10754332
232 Ga0207663_10269031
233 Ga0207662_10107527
234 Ga0207646_10746958
235 Ga0207646_11084418
236 Ga0207694_10035029
237 Ga0207650_10003018
238 Ga0207670_10390526
239 Ga0207665_10156418
240 Ga0207691_11185291
241 Ga0207711_10076726
242 Ga0207689_10153805
243 Ga0207679_10057910
244 Ga0207712_10000233
245 Ga0207668_10034588
246 Ga0207640_10847284
247 Ga0207703_11944061
248 Ga0207678_10129613
249 Ga0207702_10038730
250 Ga0207641_10285001
251 Ga0207641_10751005
252 Ga0207641_11243057
253 Ga0265760_10004113
254 Ga0265760_10016325
255 Ga0265760_10027275
256 Ga0265330_10002564
257 Ga0265330_10007705
258 Ga0265330_10021332
259 Ga0265332_10041214
260 Ga0265328_10006526
261 Ga0265328_10053673
262 Ga0265325_10082729
263 Ga0265329_10200031
264 Ga0265339_10167494
265 Ga0265331_10160917
266 Ga0265331_10345672
267 Ga0265316_10020818
268 Ga0265316_10059316
269 Ga0265313_10029637
270 Ga0265342_10018216
271 Ga0265342_10060365
272 Ga0373943_0238939
273 Ga0373931_0511429
274 Ga0373927_0013538
275 Ga0373933_0448188
276 Ga0373937_0264947
277 Ga0373937_0830005
278 Ga0451577_0317573
279 Ga0451577_0620182
280 Ga0451577_1130859
281 Ga0453684_0044371
282 Ga0466960_0074139
283 Ga0451576_0064318
284 Ga0451576_0358719
285 Ga0451576_0638784
286 Ga0451576_0975000
287 Ga0451576_1183775
288 Ga0466967_0185392
289 Ga0495592_0080971
290 Ga0495603_0260782
291 Ga0495629_0063319
292 Ga0495629_0314893
293 Ga0495641_0021851
294 Ga0495580_0000936
295 Ga0495582_0008217
296 Ga0495662_0257367
297 Ga0495664_0009809
298 Ga0495594_0011351
299 Ga0495608_0245279
300 Ga0495618_0010874
301 Ga0495628_0353737
302 Ga0495630_0038346
303 Ga0495630_0534447
304 Ga0495666_0000718
305 Ga0495665_0015657
306 Ga0495640_0021222
307 Ga0495586_0001373
308 Ga0495586_0573823
309 Ga0495667_0541816
310 Ga0495634_0025955
311 Ga0495647_0003787
312 Ga0495658_0024390
313 Ga0495658_0481035
314 Ga0495669_0003862
315 Ga0495613_0046976
316 Ga0495624_0035603
317 Ga0495600_0036283
318 Ga0495600_0058215
319 Ga0495674_0025982
320 Ga0495676_0253621
321 Ga0495680_0137754
322 Ga0495680_0324240
323 Ga0495684_0022566
324 Ga0495684_0633582
325 Ga0496106_0164172
326 Ga0496107_0421272
327 Ga0496109_0448432
328 Ga0496111_0355768
329 Ga0496112_0071619
330 Ga0496112_0309834
331 Ga0496114_0547232
332 Ga0501075_0681698
333 nmdc:mga05p37_1789840_c1
334 nmdc:mga09592_1010424_c1
335 nmdc:mga09592_9559_c1
336 nmdc:mga0qj67_675389_c1
337 nmdc:mga06r32_1469936_c1
338 nmdc:mga0rr50_550728_c1
339 nmdc:mga0a205_771025_c1
340 Ga0495601_0984443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.8236 1 127
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8116 16 136
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.7936 1 127
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7865 1 129
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.773 1 134
ID Description Score Start End Superfamily
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7847 1 128 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7666 2 129 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7599 12 124 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7473 12 136 1.20.120.450
5cogA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.741 1 126 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V9YUY0-F1-model_v4 DinB-like domain-containing protein 0.9938 9 159
AF-A0A1Q8BNA3-F1-model_v4 DinB-like domain-containing protein 0.9905 4 159
AF-A0A2V7V500-F1-model_v4 DinB-like domain-containing protein 0.9897 4 159
AF-A0A317J738-F1-model_v4 DinB-like domain-containing protein 0.9881 9 159
AF-A0A321LFL3-F1-model_v4 DinB-like domain-containing protein 0.9872 4 159

Map