F256363

General Info

Members Datasets Scaffolds Average Seq Length
170 84 170 214

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100217832|Ga0070672_1002178321
Length 232
Sequence MIRVLICDDQDVVREGLRTILSTVAGIEVVALAEDGARAVELFERHKPDMVLMDLNMPGVNGIQATRQIRAKHPDARVLALTTYDADEWVFDAIRAGAAGYLLKDTPRADLIKAIEGTVNGQTFVDPGVAGKLLTHVAGKTVVHDTTVAADLSPRERDVLSHVARGLNNGEIAERLFLSEGTVRNYVSSILAKLGVADRTQAAVIALRHGLAGNSLLTEVGIVRARRPSSAG

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
62 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
63 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
64 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
65 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
66 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
67 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
68 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
72 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
75 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
82 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
83 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
84 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 1.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.59
Rhizosphere 96.47
Stem 0
Stem Tuber 0
Unclassified 2.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10323951 3300003322 Bacteria 1680
2 Ga0070676_10300452 3300005328 Bacteria 1088
3 Ga0070666_10343672 3300005335 Bacteria 1067
4 Ga0068868_100067716 3300005338 Unclassified 2842
5 Ga0068868_100099339 3300005338 Bacteria 2354
6 Ga0070660_100349162 3300005339 Bacteria 1218
7 Ga0070668_100504304 3300005347 Bacteria 1048
8 Ga0070669_100487077 3300005353 Bacteria 1021
9 Ga0070671_100585148 3300005355 Bacteria 964
10 Ga0070674_100017641 3300005356 Unclassified 4497
11 Ga0070688_100592886 3300005365 Unclassified 847
12 Ga0070700_100278501 3300005441 Bacteria 1212
13 Ga0070678_100116600 3300005456 Bacteria 2099
14 Ga0070662_100168770 3300005457 Bacteria 1717
15 Ga0068867_100062348 3300005459 Bacteria 2770
16 Ga0068867_100741031 3300005459 Bacteria 871
17 Ga0070698_100047828 3300005471 Bacteria 4373
18 Ga0070698_101124932 3300005471 Bacteria 734
19 Ga0070679_100215151 3300005530 Bacteria 1884
20 Ga0068853_100320532 3300005539 Bacteria 1437
21 Ga0070672_100217832 3300005543 Bacteria 1600
22 Ga0070665_100032282 3300005548 Bacteria 5271
23 Ga0070704_100076482 3300005549 Bacteria 2449
24 Ga0068855_100406113 3300005563 Bacteria 1492
25 Ga0068852_101519647 3300005616 Bacteria 692
26 Ga0068859_100085546 3300005617 Bacteria 3199
27 Ga0068864_100255564 3300005618 Bacteria 1628
28 Ga0068861_100430486 3300005719 Bacteria 1178
29 Ga0068860_100758026 3300005843 Bacteria 983
30 Ga0097621_100693224 3300006237 Bacteria 937
31 Ga0075433_10015998 3300006852 Bacteria 6170
32 Ga0075434_100147709 3300006871 Bacteria 2371
33 Ga0075434_100407243 3300006871 Bacteria 1381
34 Ga0068865_100542604 3300006881 Bacteria 975
35 Ga0097620_100085553 3300006931 Bacteria 3199
36 Ga0105240_10335876 3300009093 Bacteria 1718
37 Ga0114129_10149062 3300009147 Unclassified 3202
38 Ga0114129_10174313 3300009147 Bacteria 2930
39 Ga0114129_10495962 3300009147 Bacteria 1595
40 Ga0114129_10849393 3300009147 Bacteria 1161
41 Ga0105243_10341000 3300009148 Unclassified 1373
42 Ga0105241_10173408 3300009174 Bacteria 1783
43 Ga0105246_10056560 3300011119 Bacteria 2712
44 Ga0157370_10176914 3300013104 Bacteria 1983
45 Ga0157374_10058587 3300013296 Unclassified 3599
46 Ga0157378_10045071 3300013297 Unclassified 3918
47 Ga0163162_11578676 3300013306 Bacteria 748
48 Ga0157372_10099057 3300013307 Bacteria 3325
49 Ga0157375_10035991 3300013308 Unclassified 4731
50 Ga0157380_10691111 3300014326 Bacteria 1024
51 Ga0157379_10248942 3300014968 Unclassified 1613
52 Ga0157376_10092411 3300014969 Unclassified 2623
53 Ga0207680_10035387 3300025903 Unclassified 2867
54 Ga0207680_10099273 3300025903 Bacteria 1868
55 Ga0207657_10137872 3300025919 Bacteria 1995
56 Ga0207652_10210536 3300025921 Bacteria 1750
57 Ga0207681_10421823 3300025923 Bacteria 1081
58 Ga0207644_10141813 3300025931 Bacteria 1851
59 Ga0207706_10652398 3300025933 Bacteria 901
60 Ga0207669_10027267 3300025937 Unclassified 3124
61 Ga0207704_10738938 3300025938 Bacteria 818
62 Ga0207691_10194423 3300025940 Bacteria 1768
63 Ga0207658_10036530 3300025986 Unclassified 3523
64 Ga0207658_11020842 3300025986 Bacteria 755
65 Ga0207677_10052881 3300026023 Bacteria 2762
66 Ga0207639_10328699 3300026041 Bacteria 1360
67 Ga0207648_10015641 3300026089 Bacteria 6968
68 Ga0207648_10937362 3300026089 Bacteria 810
69 Ga0207675_100446928 3300026118 Bacteria 1280
70 Ga0207683_10059996 3300026121 Unclassified 3342
71 Ga0207683_10089378 3300026121 Bacteria 2741
72 Ga0265323_10038468 3300028653 Bacteria 1749
73 Ga0316575_10002914 3300031665 Bacteria 5824
74 Ga0316575_10095214 3300031665 Bacteria 1208
75 Ga0316579_10004361 3300031691 Bacteria 5611
76 Ga0316579_10009621 3300031691 Unclassified 4069
77 Ga0316579_10249012 3300031691 Bacteria 859
78 Ga0316576_10049970 3300031727 Bacteria 3039
79 Ga0316576_10493358 3300031727 Bacteria 901
80 Ga0316578_10051213 3300031728 Bacteria 2417
81 Ga0316578_10052807 3300031728 Bacteria 2382
82 Ga0316578_10142365 3300031728 Bacteria 1444
83 Ga0316578_10251249 3300031728 Bacteria 1061
84 Ga0316577_10001319 3300031733 Bacteria 11629
85 Ga0316577_10062459 3300031733 Bacteria 2080
86 Ga0316577_10129787 3300031733 Bacteria 1418
87 Ga0316577_10303330 3300031733 Bacteria 905
88 Ga0316585_10052149 3300032137 Bacteria 1314
89 Ga0316593_10005945 3300032168 Bacteria 3261
90 Ga0316593_10021754 3300032168 Bacteria 2008
91 Ga0316574_0067281 3300035398 Bacteria 2258
92 Ga0316582_0005662 3300036647 Bacteria 6468
93 Ga0316582_0041493 3300036647 Bacteria 2876
94 Ga0316582_0111132 3300036647 Bacteria 1824
95 Ga0316582_0142365 3300036647 Bacteria 1617
96 Ga0316582_0227371 3300036647 Unclassified 1277
97 Ga0316582_0467420 3300036647 Unclassified 869
98 Ga0316584_0011899 3300036712 Bacteria 6131
99 Ga0316584_0018348 3300036712 Bacteria 5047
100 Ga0316584_0025764 3300036712 Bacteria 4316
101 Ga0316584_0058365 3300036712 Bacteria 2890
102 Ga0316584_0175641 3300036712 Bacteria 1587
103 Ga0316581_0006040 3300037588 Unclassified 3188
104 Ga0316581_0006520 3300037588 Bacteria 3095
105 Ga0316581_0012366 3300037588 Bacteria 2402
106 Ga0316581_0043629 3300037588 Bacteria 1369
107 Ga0436364_0962473 3300037853 Bacteria 7282
108 Ga0400488_43992 3300038741 Bacteria 2284
109 Ga0400489_35394 3300039093 Bacteria 2542
110 Ga0400489_68339 3300039093 Bacteria 3366
111 Ga0451577_0019652 3300042876 Bacteria 6209
112 Ga0451577_0062039 3300042876 Unclassified 3333
113 Ga0451577_0070082 3300042876 Bacteria 3127
114 Ga0451577_0228722 3300042876 Bacteria 1681
115 Ga0451577_0515908 3300042876 Bacteria 1085
116 Ga0453683_0000331 3300044673 Bacteria 58273
117 Ga0453683_0012299 3300044673 Bacteria 5610
118 Ga0453683_0039026 3300044673 Bacteria 2985
119 Ga0453683_0053813 3300044673 Bacteria 2519
120 Ga0453683_0071376 3300044673 Bacteria 2172
121 Ga0453683_0084132 3300044673 Unclassified 1993
122 Ga0453683_0091450 3300044673 Bacteria 1907
123 Ga0453684_0000012 3300044712 Bacteria 1062512
124 Ga0453684_0000023 3300044712 Bacteria 857153
125 Ga0453684_0000535 3300044712 Bacteria 144635
126 Ga0453684_0000840 3300044712 Bacteria 103623
127 Ga0453684_0001701 3300044712 Bacteria 59250
128 Ga0453684_0001965 3300044712 Bacteria 52881
129 Ga0453684_0003403 3300044712 Bacteria 35937
130 Ga0453684_0005519 3300044712 Bacteria 24966
131 Ga0453684_0006863 3300044712 Bacteria 21378
132 Ga0453684_0007987 3300044712 Bacteria 19176
133 Ga0453684_0011174 3300044712 Bacteria 15120
134 Ga0453684_0015152 3300044712 Bacteria 12231
135 Ga0453684_0019652 3300044712 Bacteria 10265
136 Ga0453684_0022723 3300044712 Bacteria 9290
137 Ga0453684_0040198 3300044712 Bacteria 6358
138 Ga0453684_0041697 3300044712 Bacteria 6201
139 Ga0453684_0068285 3300044712 Unclassified 4514
140 Ga0453684_0072845 3300044712 Bacteria 4334
141 Ga0453684_0077767 3300044712 Bacteria 4156
142 Ga0453684_0077894 3300044712 Unclassified 4151
143 Ga0453684_0098992 3300044712 Bacteria 3573
144 Ga0453684_0108822 3300044712 Unclassified 3373
145 Ga0453684_0114100 3300044712 Bacteria 3276
146 Ga0453684_0135136 3300044712 Bacteria 2954
147 Ga0453684_0137822 3300044712 Bacteria 2918
148 Ga0453684_0188912 3300044712 Unclassified 2411
149 Ga0453684_0247372 3300044712 Bacteria 2049
150 Ga0453684_0254519 3300044712 Unclassified 2015
151 Ga0453684_0254587 3300044712 Bacteria 2014
152 Ga0453684_0272396 3300044712 Bacteria 1934
153 Ga0453684_0435632 3300044712 Bacteria 1461
154 Ga0453684_0497798 3300044712 Bacteria 1350
155 Ga0453684_0529264 3300044712 Bacteria 1301
156 Ga0453684_1148566 3300044712 Bacteria 818
157 Ga0451576_0004490 3300045051 Bacteria 18067
158 Ga0451576_0106031 3300045051 Bacteria 2924
159 Ga0451576_0127544 3300045051 Bacteria 2651
160 Ga0451576_0146327 3300045051 Bacteria 2463
161 Ga0451576_0165606 3300045051 Bacteria 2307
162 Ga0451576_0636949 3300045051 Unclassified 1120
163 Ga0496104_0307047 3300048907 Bacteria 1499
164 Ga0501257_003291 3300049686 Bacteria 3455
165 nmdc:mga05p37_369715_c1 3300050507 Bacteria 1683
166 nmdc:mga05p37_48755_c1 3300050507 Bacteria 5208
167 nmdc:mga05p37_642728_c1 3300050507 Unclassified 1190
168 nmdc:mga05p37_917453_c1 3300050507 Unclassified 942
169 nmdc:mga0n895_445383_c1 3300050512 Bacteria 1308
170 nmdc:mga0a205_16469_c1 3300050515 Bacteria 6922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0175641 Ga0316584_0175641_991_1557 172
2 3300039093 Ga0400489_35394 Ga0400489_35394_125_733 187
3 3300044712 Ga0453684_0015152 Ga0453684_0015152_10137_10787 189
4 3300006871 Ga0075434_100407243 Ga0075434_1004072432 193
5 3300050512 nmdc:mga0n895_445383_c1 nmdc:mga0n895_445383_c1_132_770 193
6 3300036647 Ga0316582_0041493 Ga0316582_0041493_896_1540 196
7 3300031727 Ga0316576_10493358 Ga0316576_104933581 200
8 3300031728 Ga0316578_10142365 Ga0316578_101423652 200
9 3300044712 Ga0453684_0529264 Ga0453684_0529264_271_924 203
10 3300042876 Ga0451577_0070082 Ga0451577_0070082_220_870 205
11 3300036712 Ga0316584_0018348 Ga0316584_0018348_2953_3576 207
12 3300039093 Ga0400489_68339 Ga0400489_68339_1517_2152 208
13 3300005471 Ga0070698_101124932 Ga0070698_1011249321 210
14 3300042876 Ga0451577_0062039 Ga0451577_0062039_1770_2405 210
15 3300042876 Ga0451577_0515908 Ga0451577_0515908_200_832 210
16 3300044673 Ga0453683_0000331 Ga0453683_0000331_46317_46949 210
17 3300044673 Ga0453683_0071376 Ga0453683_0071376_692_1324 210
18 3300044673 Ga0453683_0084132 Ga0453683_0084132_931_1563 210
19 3300044673 Ga0453683_0091450 Ga0453683_0091450_535_1167 210
20 3300044712 Ga0453684_0000023 Ga0453684_0000023_227492_228124 210
21 3300044712 Ga0453684_0005519 Ga0453684_0005519_20375_21007 210
22 3300044712 Ga0453684_0068285 Ga0453684_0068285_1149_1781 210
23 3300044712 Ga0453684_0072845 Ga0453684_0072845_3004_3636 210
24 3300044712 Ga0453684_0077894 Ga0453684_0077894_3231_3863 210
25 3300044712 Ga0453684_0108822 Ga0453684_0108822_2302_2934 210
26 3300044712 Ga0453684_0137822 Ga0453684_0137822_389_1024 210
27 3300044712 Ga0453684_0188912 Ga0453684_0188912_1193_1825 210
28 3300044712 Ga0453684_0254587 Ga0453684_0254587_874_1509 210
29 3300044712 Ga0453684_0272396 Ga0453684_0272396_646_1278 210
30 3300044712 Ga0453684_0435632 Ga0453684_0435632_677_1312 210
31 3300044712 Ga0453684_1148566 Ga0453684_1148566_10_642 210
32 3300045051 Ga0451576_0004490 Ga0451576_0004490_12689_13321 210
33 3300045051 Ga0451576_0127544 Ga0451576_0127544_1867_2502 210
34 3300044712 Ga0453684_0041697 Ga0453684_0041697_2862_3533 211
35 3300044712 Ga0453684_0247372 Ga0453684_0247372_1066_1737 211
36 3300045051 Ga0451576_0146327 Ga0451576_0146327_195_866 211
37 3300009147 Ga0114129_10849393 Ga0114129_108493931 212
38 3300044712 Ga0453684_0001701 Ga0453684_0001701_46296_46934 212
39 3300044712 Ga0453684_0001965 Ga0453684_0001965_33583_34221 212
40 3300044712 Ga0453684_0497798 Ga0453684_0497798_54_719 212
41 3300049686 Ga0501257_003291 Ga0501257_003291_315_953 212
42 3300050507 nmdc:mga05p37_917453_c1 nmdc:mga05p37_917453_c1_219_884 212
43 3300005338 Ga0068868_100099339 Ga0068868_1000993392 213
44 3300005339 Ga0070660_100349162 Ga0070660_1003491622 213
45 3300005347 Ga0070668_100504304 Ga0070668_1005043042 213
46 3300005353 Ga0070669_100487077 Ga0070669_1004870771 213
47 3300005365 Ga0070688_100592886 Ga0070688_1005928861 213
48 3300005441 Ga0070700_100278501 Ga0070700_1002785011 213
49 3300005456 Ga0070678_100116600 Ga0070678_1001166001 213
50 3300005457 Ga0070662_100168770 Ga0070662_1001687701 213
51 3300005459 Ga0068867_100062348 Ga0068867_1000623482 213
52 3300005459 Ga0068867_100741031 Ga0068867_1007410311 213
53 3300005471 Ga0070698_100047828 Ga0070698_1000478283 213
54 3300005530 Ga0070679_100215151 Ga0070679_1002151512 213
55 3300005539 Ga0068853_100320532 Ga0068853_1003205322 213
56 3300005549 Ga0070704_100076482 Ga0070704_1000764821 213
57 3300005563 Ga0068855_100406113 Ga0068855_1004061132 213
58 3300005616 Ga0068852_101519647 Ga0068852_1015196471 213
59 3300005617 Ga0068859_100085546 Ga0068859_1000855464 213
60 3300005618 Ga0068864_100255564 Ga0068864_1002555642 213
61 3300005719 Ga0068861_100430486 Ga0068861_1004304862 213
62 3300006852 Ga0075433_10015998 Ga0075433_100159986 213
63 3300006871 Ga0075434_100147709 Ga0075434_1001477092 213
64 3300006881 Ga0068865_100542604 Ga0068865_1005426042 213
65 3300006931 Ga0097620_100085553 Ga0097620_1000855532 213
66 3300009093 Ga0105240_10335876 Ga0105240_103358762 213
67 3300009147 Ga0114129_10149062 Ga0114129_101490624 213
68 3300009147 Ga0114129_10174313 Ga0114129_101743132 213
69 3300009147 Ga0114129_10495962 Ga0114129_104959622 213
70 3300009148 Ga0105243_10341000 Ga0105243_103410002 213
71 3300009174 Ga0105241_10173408 Ga0105241_101734082 213
72 3300011119 Ga0105246_10056560 Ga0105246_100565604 213
73 3300013104 Ga0157370_10176914 Ga0157370_101769143 213
74 3300013306 Ga0163162_11578676 Ga0163162_115786761 213
75 3300013307 Ga0157372_10099057 Ga0157372_100990572 213
76 3300014326 Ga0157380_10691111 Ga0157380_106911112 213
77 3300025903 Ga0207680_10099273 Ga0207680_100992732 213
78 3300025919 Ga0207657_10137872 Ga0207657_101378724 213
79 3300025921 Ga0207652_10210536 Ga0207652_102105362 213
80 3300025923 Ga0207681_10421823 Ga0207681_104218231 213
81 3300025931 Ga0207644_10141813 Ga0207644_101418132 213
82 3300025933 Ga0207706_10652398 Ga0207706_106523982 213
83 3300025938 Ga0207704_10738938 Ga0207704_107389382 213
84 3300025986 Ga0207658_11020842 Ga0207658_110208422 213
85 3300026023 Ga0207677_10052881 Ga0207677_100528812 213
86 3300026041 Ga0207639_10328699 Ga0207639_103286991 213
87 3300026089 Ga0207648_10015641 Ga0207648_100156413 213
88 3300026089 Ga0207648_10937362 Ga0207648_109373621 213
89 3300026118 Ga0207675_100446928 Ga0207675_1004469282 213
90 3300026121 Ga0207683_10089378 Ga0207683_100893782 213
91 3300036647 Ga0316582_0467420 Ga0316582_0467420_15_662 213
92 3300036712 Ga0316584_0025764 Ga0316584_0025764_1270_1917 213
93 3300042876 Ga0451577_0019652 Ga0451577_0019652_3449_4090 213
94 3300044712 Ga0453684_0000012 Ga0453684_0000012_34785_35426 213
95 3300044712 Ga0453684_0019652 Ga0453684_0019652_423_1064 213
96 3300044712 Ga0453684_0098992 Ga0453684_0098992_881_1522 213
97 3300048907 Ga0496104_0307047 Ga0496104_0307047_27_668 213
98 3300050507 nmdc:mga05p37_369715_c1 nmdc:mga05p37_369715_c1_831_1472 213
99 3300050507 nmdc:mga05p37_48755_c1 nmdc:mga05p37_48755_c1_3482_4123 213
100 3300050507 nmdc:mga05p37_642728_c1 nmdc:mga05p37_642728_c1_332_973 213
101 3300050515 nmdc:mga0a205_16469_c1 nmdc:mga0a205_16469_c1_4748_5389 213
102 3300005328 Ga0070676_10300452 Ga0070676_103004521 214
103 3300005335 Ga0070666_10343672 Ga0070666_103436722 214
104 3300005338 Ga0068868_100067716 Ga0068868_1000677163 214
105 3300005355 Ga0070671_100585148 Ga0070671_1005851482 214
106 3300005356 Ga0070674_100017641 Ga0070674_1000176412 214
107 3300005548 Ga0070665_100032282 Ga0070665_1000322825 214
108 3300005843 Ga0068860_100758026 Ga0068860_1007580262 214
109 3300006237 Ga0097621_100693224 Ga0097621_1006932242 214
110 3300013296 Ga0157374_10058587 Ga0157374_100585874 214
111 3300013297 Ga0157378_10045071 Ga0157378_100450713 214
112 3300013308 Ga0157375_10035991 Ga0157375_100359912 214
113 3300014968 Ga0157379_10248942 Ga0157379_102489422 214
114 3300014969 Ga0157376_10092411 Ga0157376_100924113 214
115 3300025903 Ga0207680_10035387 Ga0207680_100353871 214
116 3300025937 Ga0207669_10027267 Ga0207669_100272672 214
117 3300025986 Ga0207658_10036530 Ga0207658_100365302 214
118 3300026121 Ga0207683_10059996 Ga0207683_100599963 214
119 3300028653 Ga0265323_10038468 Ga0265323_100384682 214
120 3300037853 Ga0436364_0962473 Ga0436364_0962473_6358_7002 214
121 3300044673 Ga0453683_0039026 Ga0453683_0039026_2019_2663 214
122 3300044712 Ga0453684_0022723 Ga0453684_0022723_5054_5698 214
123 3300045051 Ga0451576_0636949 Ga0451576_0636949_427_1071 214
124 3300031733 Ga0316577_10303330 Ga0316577_103033302 215
125 3300036712 Ga0316584_0058365 Ga0316584_0058365_42_689 215
126 3300038741 Ga0400488_43992 Ga0400488_43992_210_860 215
127 3300044712 Ga0453684_0000840 Ga0453684_0000840_19555_20205 215
128 3300044712 Ga0453684_0003403 Ga0453684_0003403_23579_24265 215
129 3300044712 Ga0453684_0011174 Ga0453684_0011174_12739_13389 215
130 3300031665 Ga0316575_10095214 Ga0316575_100952142 216
131 3300042876 Ga0451577_0228722 Ga0451577_0228722_1005_1658 216
132 3300044712 Ga0453684_0114100 Ga0453684_0114100_2116_2766 216
133 3300044712 Ga0453684_0135136 Ga0453684_0135136_1358_2011 216
134 3300044712 Ga0453684_0254519 Ga0453684_0254519_321_971 216
135 3300045051 Ga0451576_0106031 Ga0451576_0106031_1001_1654 216
136 3300031665 Ga0316575_10002914 Ga0316575_100029143 217
137 3300031691 Ga0316579_10004361 Ga0316579_100043614 217
138 3300031691 Ga0316579_10009621 Ga0316579_100096213 217
139 3300031727 Ga0316576_10049970 Ga0316576_100499703 217
140 3300031728 Ga0316578_10051213 Ga0316578_100512132 217
141 3300031728 Ga0316578_10251249 Ga0316578_102512492 217
142 3300031733 Ga0316577_10001319 Ga0316577_100013197 217
143 3300031733 Ga0316577_10129787 Ga0316577_101297872 217
144 3300032137 Ga0316585_10052149 Ga0316585_100521492 217
145 3300032168 Ga0316593_10021754 Ga0316593_100217542 217
146 3300035398 Ga0316574_0067281 Ga0316574_0067281_1036_1692 217
147 3300036647 Ga0316582_0005662 Ga0316582_0005662_342_998 217
148 3300036647 Ga0316582_0111132 Ga0316582_0111132_328_987 217
149 3300036712 Ga0316584_0011899 Ga0316584_0011899_577_1233 217
150 3300037588 Ga0316581_0006040 Ga0316581_0006040_2495_3151 217
151 3300037588 Ga0316581_0006520 Ga0316581_0006520_1332_1988 217
152 3300037588 Ga0316581_0012366 Ga0316581_0012366_593_1252 217
153 3300044673 Ga0453683_0012299 Ga0453683_0012299_1413_2066 217
154 3300044712 Ga0453684_0000535 Ga0453684_0000535_138485_139138 217
155 3300044712 Ga0453684_0006863 Ga0453684_0006863_13037_13690 217
156 3300044712 Ga0453684_0040198 Ga0453684_0040198_2282_2935 217
157 3300044712 Ga0453684_0077767 Ga0453684_0077767_1682_2335 217
158 3300045051 Ga0451576_0165606 Ga0451576_0165606_596_1249 217
159 3300005543 Ga0070672_100217832 Ga0070672_1002178321 218
160 3300025940 Ga0207691_10194423 Ga0207691_101944232 218
161 3300031691 Ga0316579_10249012 Ga0316579_102490122 218
162 3300031728 Ga0316578_10052807 Ga0316578_100528072 218
163 3300031733 Ga0316577_10062459 Ga0316577_100624592 218
164 3300032168 Ga0316593_10005945 Ga0316593_100059452 218
165 3300036647 Ga0316582_0142365 Ga0316582_0142365_794_1456 218
166 3300036647 Ga0316582_0227371 Ga0316582_0227371_33_689 218
167 3300037588 Ga0316581_0043629 Ga0316581_0043629_480_1151 218
168 3300044673 Ga0453683_0053813 Ga0453683_0053813_851_1510 218
169 3300044712 Ga0453684_0007987 Ga0453684_0007987_8959_9618 218
170 3300003322 rootL2_10323951 rootL2_103239511 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

4

116

0.98

PF00196

GerE

Bacterial regulatory proteins, luxR family

150

206

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9846 153 208
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.9768 153 214
4wul-assembly1.cif.gz_B crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9768 152 212
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.973 151 212
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9668 149 212
ID Description Score Start End Superfamily
4hyeB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9933 153 211 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9846 153 208 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9835 153 209 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9648 153 210 1.10.10.10
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9642 150 209 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0K8PQY2-F1-model_v4 Two-component system response regulator 0.9668 5 128 GO:0000160
GO:0003677
AF-A0A6I0E9X0-F1-model_v4 Response regulator transcription factor 0.9663 2 127 GO:0000160
AF-A0A3C1KG35-F1-model_v4 DNA-binding response regulator 0.9662 2 142 GO:0000160
GO:0003677
AF-A0A2W2CUA7-F1-model_v4 DNA-binding response regulator 0.9612 2 116 GO:0000160
GO:0003677
AF-A0A258B360-F1-model_v4 Response regulatory domain-containing protein 0.9568 2 128 GO:0000160

Feature Viewer

pLDDT pTM Quality
87.74 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map