F255596

General Info

Members Datasets Scaffolds Average Seq Length
169 112 338 163

Family's Representative Sequence

Representative Sequence 3300049705|Ga0501225_0117386|Ga0501225_0117386_143_634
Length 163
Sequence MSHSAEQQTIFTMGDIRDVVIYPIKKFFDDRGWLAELFRHDELEEEFYPVISFTRPGVRRGPHEHVEQADLFCFIGPSSFDLRLWDNRPDSPTYRNMISVVAGEENPLAVIVPKGVAHGYKNVGTVDGMVINCPNRLYMGQGKKEPIDEIRHEDDPETVFRFD

Samples

Sample ID Description Type Environment
1 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
104 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
105 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
106 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
107 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
110 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
111 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
112 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 2.37
Rhizosphere 96.45
Stem 0
Stem Tuber 0
Unclassified 20.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501225_0117386 3300049705 Unclassified 788
2 LJQas_1003949 3300000549 Unclassified 1955
3 Ga0065704_10110184 3300005289 Bacteria 1986
4 Ga0065707_10103703 3300005295 Bacteria 2734
5 Ga0070670_100018069 3300005331 Bacteria 6052
6 Ga0068868_100110315 3300005338 Bacteria 2235
7 Ga0070668_100479391 3300005347 Bacteria 1074
8 Ga0070669_100058546 3300005353 Unclassified 2828
9 Ga0070669_100245910 3300005353 Bacteria 1423
10 Ga0070675_100182078 3300005354 Bacteria 1817
11 Ga0070671_100224580 3300005355 Bacteria 1593
12 Ga0070674_100020831 3300005356 Unclassified 4199
13 Ga0070674_100137024 3300005356 Bacteria 1832
14 Ga0070673_100171195 3300005364 Bacteria 1854
15 Ga0070673_101027584 3300005364 Unclassified 768
16 Ga0070711_100382759 3300005439 Bacteria 1138
17 Ga0070705_100207673 3300005440 Bacteria 1347
18 Ga0070705_100215809 3300005440 Bacteria 1325
19 Ga0070694_100638199 3300005444 Unclassified 861
20 Ga0070678_100688155 3300005456 Unclassified 920
21 Ga0070685_10019128 3300005466 Bacteria 3692
22 Ga0070707_100000456 3300005468 Bacteria 40527
23 Ga0070699_100270919 3300005518 Bacteria 1519
24 Ga0070699_101108065 3300005518 Unclassified 726
25 Ga0070697_100035252 3300005536 Bacteria 4035
26 Ga0070697_100538928 3300005536 Bacteria 1023
27 Ga0068853_100027815 3300005539 Bacteria 4754
28 Ga0070672_100446838 3300005543 Bacteria 1113
29 Ga0070686_100656863 3300005544 Bacteria 832
30 Ga0070664_100486788 3300005564 Bacteria 1136
31 Ga0068854_100816464 3300005578 Bacteria 814
32 Ga0068856_100211071 3300005614 Bacteria 1957
33 Ga0068852_101370974 3300005616 Bacteria 729
34 Ga0068864_100378121 3300005618 Bacteria 1341
35 Ga0068861_100301623 3300005719 Bacteria 1388
36 Ga0068861_101130057 3300005719 Bacteria 754
37 Ga0068863_100465786 3300005841 Bacteria 1241
38 Ga0068862_100063512 3300005844 Bacteria 3177
39 Ga0068862_100996567 3300005844 Bacteria 828
40 Ga0070717_10057362 3300006028 Bacteria 3219
41 Ga0097621_100109855 3300006237 Bacteria 2329
42 Ga0068871_100551016 3300006358 Unclassified 1044
43 Ga0075433_10463110 3300006852 Unclassified 1117
44 Ga0097620_100286443 3300006931 Unclassified 1740
45 Ga0099794_10117115 3300007265 Bacteria 1338
46 Ga0111539_10160304 3300009094 Archaea 2631
47 Ga0105243_10604084 3300009148 Bacteria 1056
48 Ga0105241_10715689 3300009174 Unclassified 915
49 Ga0105241_12169781 3300009174 Bacteria 550
50 Ga0105248_10957235 3300009177 Bacteria 967
51 Ga0105237_10803030 3300009545 Unclassified 948
52 Ga0105249_10023061 3300009553 Bacteria 5581
53 Ga0105249_10394802 3300009553 Bacteria 1412
54 Ga0157374_11086587 3300013296 Unclassified 820
55 Ga0157378_10260894 3300013297 Bacteria 1662
56 Ga0163162_10008893 3300013306 Bacteria 9768
57 Ga0163162_10100308 3300013306 Unclassified 2986
58 Ga0163162_10972808 3300013306 Unclassified 959
59 Ga0157372_10219905 3300013307 Bacteria 2202
60 Ga0157375_10035108 3300013308 Unclassified 4783
61 Ga0157375_10038803 3300013308 Bacteria 4576
62 Ga0157375_10282588 3300013308 Bacteria 1823
63 Ga0163163_11688701 3300014325 Bacteria 694
64 Ga0163163_11711165 3300014325 Bacteria 689
65 Ga0157380_10067876 3300014326 Bacteria 2873
66 Ga0157380_10949277 3300014326 Unclassified 890
67 Ga0157379_10636806 3300014968 Unclassified 997
68 Ga0157376_10245717 3300014969 Bacteria 1669
69 Ga0182005_1113318 3300015265 Bacteria 767
70 Ga0163161_11406312 3300017792 Bacteria 609
71 Ga0207642_10149817 3300025899 Bacteria 1240
72 Ga0207643_10397485 3300025908 Unclassified 871
73 Ga0207684_10077113 3300025910 Bacteria 2833
74 Ga0207654_10136856 3300025911 Bacteria 1557
75 Ga0207663_10293005 3300025916 Bacteria 1213
76 Ga0207646_10000480 3300025922 Bacteria 53452
77 Ga0207646_10797733 3300025922 Bacteria 841
78 Ga0207681_10440893 3300025923 Bacteria 1058
79 Ga0207681_10475483 3300025923 Bacteria 1020
80 Ga0207650_10085586 3300025925 Bacteria 2399
81 Ga0207659_10061810 3300025926 Bacteria 2701
82 Ga0207659_10339063 3300025926 Bacteria 1244
83 Ga0207700_10600835 3300025928 Bacteria 979
84 Ga0207669_10173354 3300025937 Bacteria 1538
85 Ga0207704_10406810 3300025938 Bacteria 1075
86 Ga0207679_10563418 3300025945 Bacteria 1023
87 Ga0207712_10003892 3300025961 Bacteria 9438
88 Ga0207712_10261265 3300025961 Bacteria 1404
89 Ga0207668_10235250 3300025972 Bacteria 1479
90 Ga0207703_10439086 3300026035 Bacteria 1217
91 Ga0207702_10500286 3300026078 Bacteria 1185
92 Ga0207641_10284529 3300026088 Bacteria 1556
93 Ga0207676_10231302 3300026095 Bacteria 1653
94 Ga0207676_10299390 3300026095 Bacteria 1468
95 Ga0207675_100147763 3300026118 Unclassified 2236
96 Ga0207683_11334428 3300026121 Unclassified 664
97 Ga0268266_10034967 3300028379 Bacteria 4274
98 Ga0268265_10198737 3300028380 Bacteria 1737
99 Ga0268265_11447969 3300028380 Unclassified 690
100 Ga0307408_100026798 3300031548 Bacteria 3964
101 Ga0307408_100291942 3300031548 Bacteria 1362
102 Ga0307408_100492223 3300031548 Archaea 1072
103 Ga0307408_101081746 3300031548 Unclassified 743
104 Ga0307405_10649422 3300031731 Bacteria 867
105 Ga0307413_10020007 3300031824 Bacteria 3550
106 Ga0307410_10031436 3300031852 Bacteria 3406
107 Ga0307410_10282724 3300031852 Bacteria 1303
108 Ga0307410_10522397 3300031852 Bacteria 980
109 Ga0307410_10705117 3300031852 Bacteria 851
110 Ga0307410_10806193 3300031852 Bacteria 799
111 Ga0307410_10826990 3300031852 Unclassified 789
112 Ga0307406_10015114 3300031901 Bacteria 4460
113 Ga0307406_10289660 3300031901 Unclassified 1253
114 Ga0307407_10001448 3300031903 Bacteria 8589
115 Ga0307407_10791415 3300031903 Bacteria 721
116 Ga0307412_10101703 3300031911 Bacteria 2034
117 Ga0307412_10272950 3300031911 Unclassified 1324
118 Ga0307409_100055146 3300031995 Unclassified 3067
119 Ga0307409_101006759 3300031995 Unclassified 851
120 Ga0307409_101818223 3300031995 Bacteria 638
121 Ga0307409_101926594 3300031995 Bacteria 620
122 Ga0307416_100064852 3300032002 Bacteria 2998
123 Ga0307416_100535658 3300032002 Bacteria 1242
124 Ga0307416_101419895 3300032002 Bacteria 800
125 Ga0307416_101540931 3300032002 Bacteria 770
126 Ga0307416_101581874 3300032002 Unclassified 761
127 Ga0307416_102992327 3300032002 Unclassified 565
128 Ga0307414_10148589 3300032004 Bacteria 1845
129 Ga0307414_10272007 3300032004 Bacteria 1419
130 Ga0307411_10092590 3300032005 Bacteria 2114
131 Ga0307411_10229500 3300032005 Bacteria 1446
132 Ga0307411_10251861 3300032005 Bacteria 1389
133 Ga0307415_100004951 3300032126 Bacteria 7009
134 Ga0307415_100309178 3300032126 Bacteria 1313
135 Ga0307415_101768171 3300032126 Bacteria 597
136 Ga0373960_0233705 3300035121 Bacteria 662
137 Ga0436365_1753418 3300039437 Bacteria 95553
138 Ga0451577_0000031 3300042876 Bacteria 388524
139 Ga0451577_0066443 3300042876 Bacteria 3216
140 Ga0453683_0000058 3300044673 Bacteria 189089
141 Ga0453683_0003646 3300044673 Bacteria 11289
142 Ga0453683_0035442 3300044673 Bacteria 3144
143 Ga0453683_0157698 3300044673 Bacteria 1435
144 Ga0453683_0326875 3300044673 Bacteria 983
145 Ga0453684_0030838 3300044712 Bacteria 7561
146 Ga0453684_0039484 3300044712 Bacteria 6431
147 Ga0453684_0287897 3300044712 Unclassified 1871
148 Ga0453684_0446080 3300044712 Bacteria 1441
149 Ga0451576_0009757 3300045051 Bacteria 11098
150 Ga0451576_0019211 3300045051 Bacteria 7463
151 Ga0451576_0489610 3300045051 Bacteria 1292
152 Ga0495667_0023321 3300046559 Bacteria 4170
153 Ga0495604_0045618 3300047317 Bacteria 3420
154 Ga0496104_0062560 3300048907 Bacteria 3529
155 Ga0496108_0607070 3300048911 Bacteria 953
156 Ga0496109_0148871 3300048912 Bacteria 2191
157 Ga0496110_0136007 3300048913 Bacteria 2221
158 Ga0501072_0037989 3300049588 Bacteria 3778
159 Ga0501198_020312 3300049649 Unclassified 1052
160 Ga0501209_065702 3300049656 Bacteria 1022
161 Ga0501235_041637 3300049669 Bacteria 1051
162 Ga0501235_052639 3300049669 Bacteria 945
163 Ga0501257_193228 3300049686 Unclassified 582
164 Ga0501221_050320 3300049704 Bacteria 937
165 nmdc:mga0n895_484210_c1 3300050512 Unclassified 1247
166 Ga0495601_0009919 3300053077 Bacteria 5643
167 Ga0495619_0030503 3300053085 Bacteria 3490
168 Ga0500616_0002625 3300053153 Bacteria 14673
169 Ga0501082_0463725 3300060353 Bacteria 1107
170 Ga0501225_0117386
171 LJQas_1003949
172 Ga0065704_10110184
173 Ga0065707_10103703
174 Ga0070670_100018069
175 Ga0068868_100110315
176 Ga0070668_100479391
177 Ga0070669_100058546
178 Ga0070669_100245910
179 Ga0070675_100182078
180 Ga0070671_100224580
181 Ga0070674_100020831
182 Ga0070674_100137024
183 Ga0070673_100171195
184 Ga0070673_101027584
185 Ga0070711_100382759
186 Ga0070705_100207673
187 Ga0070705_100215809
188 Ga0070694_100638199
189 Ga0070678_100688155
190 Ga0070685_10019128
191 Ga0070707_100000456
192 Ga0070699_100270919
193 Ga0070699_101108065
194 Ga0070697_100035252
195 Ga0070697_100538928
196 Ga0068853_100027815
197 Ga0070672_100446838
198 Ga0070686_100656863
199 Ga0070664_100486788
200 Ga0068854_100816464
201 Ga0068856_100211071
202 Ga0068852_101370974
203 Ga0068864_100378121
204 Ga0068861_100301623
205 Ga0068861_101130057
206 Ga0068863_100465786
207 Ga0068862_100063512
208 Ga0068862_100996567
209 Ga0070717_10057362
210 Ga0097621_100109855
211 Ga0068871_100551016
212 Ga0075433_10463110
213 Ga0097620_100286443
214 Ga0099794_10117115
215 Ga0111539_10160304
216 Ga0105243_10604084
217 Ga0105241_10715689
218 Ga0105241_12169781
219 Ga0105248_10957235
220 Ga0105237_10803030
221 Ga0105249_10023061
222 Ga0105249_10394802
223 Ga0157374_11086587
224 Ga0157378_10260894
225 Ga0163162_10008893
226 Ga0163162_10100308
227 Ga0163162_10972808
228 Ga0157372_10219905
229 Ga0157375_10035108
230 Ga0157375_10038803
231 Ga0157375_10282588
232 Ga0163163_11688701
233 Ga0163163_11711165
234 Ga0157380_10067876
235 Ga0157380_10949277
236 Ga0157379_10636806
237 Ga0157376_10245717
238 Ga0182005_1113318
239 Ga0163161_11406312
240 Ga0207642_10149817
241 Ga0207643_10397485
242 Ga0207684_10077113
243 Ga0207654_10136856
244 Ga0207663_10293005
245 Ga0207646_10000480
246 Ga0207646_10797733
247 Ga0207681_10440893
248 Ga0207681_10475483
249 Ga0207650_10085586
250 Ga0207659_10061810
251 Ga0207659_10339063
252 Ga0207700_10600835
253 Ga0207669_10173354
254 Ga0207704_10406810
255 Ga0207679_10563418
256 Ga0207712_10003892
257 Ga0207712_10261265
258 Ga0207668_10235250
259 Ga0207703_10439086
260 Ga0207702_10500286
261 Ga0207641_10284529
262 Ga0207676_10231302
263 Ga0207676_10299390
264 Ga0207675_100147763
265 Ga0207683_11334428
266 Ga0268266_10034967
267 Ga0268265_10198737
268 Ga0268265_11447969
269 Ga0307408_100026798
270 Ga0307408_100291942
271 Ga0307408_100492223
272 Ga0307408_101081746
273 Ga0307405_10649422
274 Ga0307413_10020007
275 Ga0307410_10031436
276 Ga0307410_10282724
277 Ga0307410_10522397
278 Ga0307410_10705117
279 Ga0307410_10806193
280 Ga0307410_10826990
281 Ga0307406_10015114
282 Ga0307406_10289660
283 Ga0307407_10001448
284 Ga0307407_10791415
285 Ga0307412_10101703
286 Ga0307412_10272950
287 Ga0307409_100055146
288 Ga0307409_101006759
289 Ga0307409_101818223
290 Ga0307409_101926594
291 Ga0307416_100064852
292 Ga0307416_100535658
293 Ga0307416_101419895
294 Ga0307416_101540931
295 Ga0307416_101581874
296 Ga0307416_102992327
297 Ga0307414_10148589
298 Ga0307414_10272007
299 Ga0307411_10092590
300 Ga0307411_10229500
301 Ga0307411_10251861
302 Ga0307415_100004951
303 Ga0307415_100309178
304 Ga0307415_101768171
305 Ga0373960_0233705
306 Ga0436365_1753418
307 Ga0451577_0000031
308 Ga0451577_0066443
309 Ga0453683_0000058
310 Ga0453683_0003646
311 Ga0453683_0035442
312 Ga0453683_0157698
313 Ga0453683_0326875
314 Ga0453684_0030838
315 Ga0453684_0039484
316 Ga0453684_0287897
317 Ga0453684_0446080
318 Ga0451576_0009757
319 Ga0451576_0019211
320 Ga0451576_0489610
321 Ga0495667_0023321
322 Ga0495604_0045618
323 Ga0496104_0062560
324 Ga0496108_0607070
325 Ga0496109_0148871
326 Ga0496110_0136007
327 Ga0501072_0037989
328 Ga0501198_020312
329 Ga0501209_065702
330 Ga0501235_041637
331 Ga0501235_052639
332 Ga0501257_193228
333 Ga0501221_050320
334 nmdc:mga0n895_484210_c1
335 Ga0495601_0009919
336 Ga0495619_0030503
337 Ga0500616_0002625
338 Ga0501082_0463725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

13

154

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ejk-assembly1.cif.gz_A-2 crystal structure of dtdp sugar isomerase (yp_390184.1) from desulfovibrio desulfuricans g20 at 1.95 a resolution 0.8905 16 155
3smh-assembly1.cif.gz_A crystal structure of major peanut allergen ara h 1 0.8817 52 138
3smh-assembly2.cif.gz_E crystal structure of major peanut allergen ara h 1 0.8814 52 138
3smh-assembly1.cif.gz_D crystal structure of major peanut allergen ara h 1 0.8814 52 138
3smh-assembly2.cif.gz_B crystal structure of major peanut allergen ara h 1 0.8812 52 138
ID Description Score Start End Superfamily
af_Q652P9_24_210_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9121 52 139 2.60.120.10
af_A0A1D6KN97_1_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8952 52 139 2.60.120.10
af_O06336_46_171_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.893 52 155 2.60.120.10
5e1rB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8908 52 136 2.60.120.10
2vqaC01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.89 52 155 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7V9UUP3-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase family protein 1 43 167 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A832FU38-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.99 16 167 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A2M6YXB4-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9895 11 167 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7W0F818-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.987 10 161 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A2H0V8T8-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9824 15 167 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map