F255133

General Info

Members Datasets Scaffolds Average Seq Length
169 127 169 346

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0223376|Ga0316584_0223376_81_1208
Length 375
Sequence MRIEAGEGKWEFPFGNIPRTGRSQEGIPMEGILVCLGRGANRRFRKKVRECVDAKLKTRYFIILSLDAGRSPADTARALEVSVRTVYRVRKRFIKYGEAGLIDRREENGFRKVDEDYLEVLHEVVKSYSWEYGWPRPTWTQEMLVKTMKEITGVEVSVSTMSRALKKLRARHGRPKPTVGCPWPQATKTKRLRAIRKLLDNLPANEVAFYEDEVDIHLNPKIGPDWMVRGQQKEVPTPGQNEKRYLAGAQDVRTGELIWVEGERKNSPLFILLLWELVQKHPQAKVVHVILDNYSIHHTQQVTTTLQTPEGQRIKLHFLPPYCPDDNKIERTWQDLHANVTRNHRCLTIKELMRAVRRYLRQRNRKIQLDHHLAA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
82 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
93 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
94 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
117 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
126 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 1.78
Rhizosphere 97.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100176889 3300005329 Bacteria 2026
2 Ga0070683_100273890 3300005329 Bacteria 1605
3 Ga0070670_100221587 3300005331 Unclassified 1646
4 Ga0070670_100229229 3300005331 Bacteria 1616
5 Ga0070666_10145589 3300005335 Unclassified 1651
6 Ga0070680_100322927 3300005336 Bacteria 1310
7 Ga0070680_100334034 3300005336 Bacteria 1287
8 Ga0070682_100228717 3300005337 Bacteria 1328
9 Ga0070661_100162860 3300005344 Bacteria 1690
10 Ga0070675_100196112 3300005354 Bacteria 1751
11 Ga0070714_100348215 3300005435 Bacteria 1391
12 Ga0070713_100399748 3300005436 Unclassified 1283
13 Ga0070705_100137061 3300005440 Bacteria 1605
14 Ga0070681_10229458 3300005458 Bacteria 1771
15 Ga0070681_10354597 3300005458 Bacteria 1377
16 Ga0070679_100374168 3300005530 Bacteria 1371
17 Ga0070684_100429149 3300005535 Bacteria 1220
18 Ga0068853_100269113 3300005539 Bacteria 1568
19 Ga0070665_100546627 3300005548 Bacteria 1170
20 Ga0068855_100151649 3300005563 Bacteria 2635
21 Ga0068855_100459172 3300005563 Bacteria 1389
22 Ga0070664_100246600 3300005564 Bacteria 1604
23 Ga0068857_100255145 3300005577 Bacteria 1608
24 Ga0068857_100383099 3300005577 Bacteria 1306
25 Ga0068854_100264864 3300005578 Bacteria 1377
26 Ga0068856_100286821 3300005614 Unclassified 1663
27 Ga0068856_100354747 3300005614 Bacteria 1485
28 Ga0068856_100437186 3300005614 Unclassified 1329
29 Ga0068852_100165849 3300005616 Bacteria 2067
30 Ga0068852_100361552 3300005616 Unclassified 1420
31 Ga0068864_100330456 3300005618 Bacteria 1434
32 Ga0068851_10104947 3300005834 Bacteria 1503
33 Ga0068870_10108127 3300005840 Bacteria 1583
34 Ga0068863_100426250 3300005841 Bacteria 1300
35 Ga0081539_10100359 3300005985 Bacteria 1477
36 Ga0097621_100339419 3300006237 Bacteria 1334
37 Ga0068871_100302384 3300006358 Bacteria 1404
38 Ga0068871_100334547 3300006358 Bacteria 1336
39 Ga0075428_100308540 3300006844 Bacteria 1701
40 Ga0075430_100327818 3300006846 Bacteria 1265
41 Ga0075431_100447615 3300006847 Bacteria 1287
42 Ga0075433_10269972 3300006852 Unclassified 1508
43 Ga0075433_10462980 3300006852 Unclassified 1117
44 Ga0075434_100188228 3300006871 Unclassified 2084
45 Ga0075429_100072909 3300006880 Plasmid 2990
46 Ga0075429_100341621 3300006880 Bacteria 1310
47 Ga0075429_100407704 3300006880 Bacteria 1190
48 Ga0099794_10083620 3300007265 Unclassified 1577
49 Ga0105240_10248820 3300009093 Bacteria 2057
50 Ga0105240_10558836 3300009093 Unclassified 1265
51 Ga0111539_10414727 3300009094 Bacteria 1568
52 Ga0105245_10044875 3300009098 Unclassified 3946
53 Ga0105241_10073806 3300009174 Bacteria 2655
54 Ga0105242_10189918 3300009176 Unclassified 1818
55 Ga0105248_10527578 3300009177 Unclassified 1332
56 Ga0105237_10158634 3300009545 Bacteria 2260
57 Ga0105237_10565363 3300009545 Unclassified 1144
58 Ga0105238_10093436 3300009551 Bacteria 2996
59 Ga0105239_10399267 3300010375 Unclassified 1556
60 Ga0105239_10422898 3300010375 Bacteria 1509
61 Ga0105239_10431281 3300010375 Bacteria 1494
62 Ga0157373_10132934 3300013100 Bacteria 1749
63 Ga0157371_10193234 3300013102 Bacteria 1458
64 Ga0157370_10207151 3300013104 Bacteria 1818
65 Ga0157369_10340820 3300013105 Bacteria 1557
66 Ga0157369_10465190 3300013105 Unclassified 1309
67 Ga0157369_10497447 3300013105 Bacteria 1261
68 Ga0157374_10346367 3300013296 Unclassified 1476
69 Ga0157378_10226642 3300013297 Bacteria 1779
70 Ga0157378_10417159 3300013297 Unclassified 1326
71 Ga0157372_10038389 3300013307 Bacteria 5284
72 Ga0157372_10255948 3300013307 Bacteria 2032
73 Ga0157372_10525655 3300013307 Bacteria 1379
74 Ga0157372_10609868 3300013307 Unclassified 1272
75 Ga0157375_10578900 3300013308 Unclassified 1283
76 Ga0163163_10400093 3300014325 Unclassified 1431
77 Ga0157376_10347601 3300014969 Unclassified 1418
78 Ga0206356_11893423 3300020070 Bacteria 1393
79 Ga0207656_10112256 3300025321 Bacteria 1261
80 Ga0207643_10072538 3300025908 Bacteria 1983
81 Ga0207654_10044073 3300025911 Bacteria 2532
82 Ga0207707_10309139 3300025912 Bacteria 1366
83 Ga0207695_10402282 3300025913 Bacteria 1254
84 Ga0207671_10305766 3300025914 Bacteria 1257
85 Ga0207657_10333767 3300025919 Unclassified 1197
86 Ga0207649_10260994 3300025920 Bacteria 1252
87 Ga0207652_10385013 3300025921 Bacteria 1266
88 Ga0207694_10334203 3300025924 Bacteria 1252
89 Ga0207650_10197204 3300025925 Bacteria 1611
90 Ga0207659_10339656 3300025926 Bacteria 1243
91 Ga0207687_10044819 3300025927 Unclassified 3054
92 Ga0207687_10160937 3300025927 Bacteria 1723
93 Ga0207700_10373299 3300025928 Unclassified 1246
94 Ga0207661_10392411 3300025944 Bacteria 1257
95 Ga0207679_10137420 3300025945 Bacteria 1970
96 Ga0207667_10147372 3300025949 Unclassified 2423
97 Ga0207667_10482597 3300025949 Bacteria 1258
98 Ga0207640_10322670 3300025981 Bacteria 1230
99 Ga0207639_10362907 3300026041 Unclassified 1296
100 Ga0207639_10394047 3300026041 Bacteria 1246
101 Ga0207702_10444739 3300026078 Bacteria 1257
102 Ga0207702_10453783 3300026078 Unclassified 1244
103 Ga0207641_10400911 3300026088 Bacteria 1317
104 Ga0207676_10257676 3300026095 Bacteria 1573
105 Ga0207674_10518301 3300026116 Bacteria 1152
106 Ga0207698_10378928 3300026142 Bacteria 1345
107 Ga0207698_10544219 3300026142 Unclassified 1137
108 Ga0268266_10120912 3300028379 Bacteria 2330
109 Ga0268266_10470928 3300028379 Bacteria 1196
110 Ga0265334_10041843 3300028573 Bacteria 1788
111 Ga0265323_10029508 3300028653 Bacteria 2051
112 Ga0265338_10252385 3300028800 Bacteria 1300
113 Ga0265324_10045734 3300029957 Bacteria 1507
114 Ga0265325_10003607 3300031241 Bacteria 10043
115 Ga0265339_10103872 3300031249 Bacteria 1476
116 Ga0265331_10003148 3300031250 Bacteria 10771
117 Ga0265327_10084975 3300031251 Bacteria 1554
118 Ga0265316_10143111 3300031344 Unclassified 1795
119 Ga0265313_10010244 3300031595 Bacteria 5963
120 Ga0265313_10043774 3300031595 Bacteria 2189
121 Ga0265313_10094013 3300031595 Unclassified 1340
122 Ga0265342_10120540 3300031712 Unclassified 1477
123 Ga0316576_10132198 3300031727 Bacteria 1877
124 Ga0316578_10154686 3300031728 Bacteria 1382
125 Ga0373936_0075950 3300035113 Bacteria 1391
126 Ga0373955_0074331 3300035172 Bacteria 1907
127 Ga0373933_0214674 3300035724 Bacteria 1233
128 Ga0316584_0223376 3300036712 Bacteria 1383
129 Ga0395900_0490688 3300037418 Bacteria 1180
130 Ga0395905_0354061 3300037471 Bacteria 1360
131 Ga0395901_0543400 3300038443 Unclassified 1178
132 Ga0436360_1150562 3300039438 Bacteria 1687
133 Ga0436362_0974702 3300039453 Unclassified 1747
134 Ga0451577_0094000 3300042876 Bacteria 2677
135 Ga0451577_0210672 3300042876 Bacteria 1755
136 Ga0466969_0026101 3300044656 Bacteria 2998
137 Ga0466972_0082071 3300044658 Bacteria 1534
138 Ga0453683_0003139 3300044673 Bacteria 12328
139 Ga0453683_0084686 3300044673 Bacteria 1986
140 Ga0466965_0114235 3300044683 Bacteria 1390
141 Ga0466966_0171230 3300044684 Bacteria 1319
142 Ga0466961_0162390 3300044693 Bacteria 1392
143 Ga0453684_0000119 3300044712 Bacteria 345920
144 Ga0453684_0004600 3300044712 Bacteria 28758
145 Ga0453684_0137491 3300044712 Bacteria 2922
146 Ga0453684_0148451 3300044712 Unclassified 2789
147 Ga0453684_0267726 3300044712 Bacteria 1954
148 Ga0453684_0268625 3300044712 Bacteria 1950
149 Ga0466968_0068641 3300044735 Bacteria 1539
150 Ga0466959_0222429 3300045049 Bacteria 1309
151 Ga0466959_0315948 3300045049 Bacteria 1068
152 Ga0451576_0273941 3300045051 Bacteria 1764
153 Ga0451576_0351932 3300045051 Bacteria 1542
154 Ga0495584_0123510 3300046491 Bacteria 1311
155 Ga0495585_0153085 3300046492 Bacteria 1201
156 Ga0495598_0027789 3300046537 Bacteria 1563
157 Ga0495633_0079294 3300046558 Bacteria 1529
158 Ga0495656_0101310 3300046615 Unclassified 1332
159 Ga0495636_0074053 3300047318 Bacteria 1458
160 Ga0496104_0164649 3300048907 Bacteria 2126
161 Ga0496114_0349557 3300048917 Bacteria 1307
162 Ga0496115_0220370 3300048918 Unclassified 1565
163 nmdc:mga09592_140600_c1 3300050508 Bacteria 2081
164 nmdc:mga09592_16038_c1 3300050508 Bacteria 6125
165 nmdc:mga09592_47869_c1 3300050508 Bacteria 3604
166 nmdc:mga06r32_511174_c1 3300050510 Bacteria 1178
167 Ga0495619_0189773 3300053085 Unclassified 1422
168 Ga0500616_0067345 3300053153 Unclassified 1836
169 Ga0501082_0141006 3300060353 Unclassified 2092

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_10400093 Ga0163163_104000932 285
2 3300042876 Ga0451577_0210672 Ga0451577_0210672_49_990 312
3 3300044712 Ga0453684_0000119 Ga0453684_0000119_209683_210624 312
4 3300050508 nmdc:mga09592_16038_c1 nmdc:mga09592_16038_c1_5130_6077 315
5 3300047318 Ga0495636_0074053 Ga0495636_0074053_232_1200 316
6 3300009545 Ga0105237_10565363 Ga0105237_105653631 317
7 3300005578 Ga0068854_100264864 Ga0068854_1002648641 319
8 3300045049 Ga0466959_0315948 Ga0466959_0315948_66_1052 321
9 3300046615 Ga0495656_0101310 Ga0495656_0101310_200_1186 326
10 3300005985 Ga0081539_10100359 Ga0081539_101003592 330
11 3300009094 Ga0111539_10414727 Ga0111539_104147272 330
12 3300042876 Ga0451577_0094000 Ga0451577_0094000_569_1570 331
13 3300044673 Ga0453683_0003139 Ga0453683_0003139_3983_5107 331
14 3300044673 Ga0453683_0084686 Ga0453683_0084686_279_1280 331
15 3300044712 Ga0453684_0137491 Ga0453684_0137491_78_1079 331
16 3300044712 Ga0453684_0268625 Ga0453684_0268625_217_1341 331
17 3300007265 Ga0099794_10083620 Ga0099794_100836201 332
18 3300050508 nmdc:mga09592_47869_c1 nmdc:mga09592_47869_c1_702_1700 332
19 3300025919 Ga0207657_10333767 Ga0207657_103337671 333
20 3300028573 Ga0265334_10041843 Ga0265334_100418432 333
21 3300031595 Ga0265313_10043774 Ga0265313_100437742 333
22 3300037471 Ga0395905_0354061 Ga0395905_0354061_186_1199 333
23 3300044683 Ga0466965_0114235 Ga0466965_0114235_347_1354 333
24 3300044712 Ga0453684_0004600 Ga0453684_0004600_25697_26704 333
25 3300053153 Ga0500616_0067345 Ga0500616_0067345_454_1479 333
26 3300010375 Ga0105239_10399267 Ga0105239_103992672 337
27 3300028653 Ga0265323_10029508 Ga0265323_100295081 337
28 3300044712 Ga0453684_0148451 Ga0453684_0148451_1169_2221 339
29 3300039438 Ga0436360_1150562 Ga0436360_1150562_306_1376 340
30 3300035113 Ga0373936_0075950 Ga0373936_0075950_194_1228 342
31 3300035172 Ga0373955_0074331 Ga0373955_0074331_631_1665 342
32 3300035724 Ga0373933_0214674 Ga0373933_0214674_119_1153 342
33 3300045051 Ga0451576_0273941 Ga0451576_0273941_693_1727 342
34 3300005440 Ga0070705_100137061 Ga0070705_1001370612 343
35 3300038443 Ga0395901_0543400 Ga0395901_0543400_126_1160 343
36 3300046491 Ga0495584_0123510 Ga0495584_0123510_162_1196 343
37 3300005548 Ga0070665_100546627 Ga0070665_1005466271 344
38 3300010375 Ga0105239_10422898 Ga0105239_104228982 344
39 3300013105 Ga0157369_10497447 Ga0157369_104974471 344
40 3300013297 Ga0157378_10226642 Ga0157378_102266422 344
41 3300028379 Ga0268266_10470928 Ga0268266_104709281 344
42 3300039453 Ga0436362_0974702 Ga0436362_0974702_206_1246 344
43 3300048907 Ga0496104_0164649 Ga0496104_0164649_75_1112 344
44 3300048917 Ga0496114_0349557 Ga0496114_0349557_198_1235 344
45 3300048918 Ga0496115_0220370 Ga0496115_0220370_464_1501 344
46 3300053085 Ga0495619_0189773 Ga0495619_0189773_311_1348 344
47 3300005329 Ga0070683_100273890 Ga0070683_1002738901 345
48 3300005331 Ga0070670_100221587 Ga0070670_1002215871 345
49 3300005335 Ga0070666_10145589 Ga0070666_101455891 345
50 3300005336 Ga0070680_100322927 Ga0070680_1003229271 345
51 3300005337 Ga0070682_100228717 Ga0070682_1002287171 345
52 3300005458 Ga0070681_10229458 Ga0070681_102294581 345
53 3300005530 Ga0070679_100374168 Ga0070679_1003741681 345
54 3300005535 Ga0070684_100429149 Ga0070684_1004291491 345
55 3300005539 Ga0068853_100269113 Ga0068853_1002691132 345
56 3300005563 Ga0068855_100151649 Ga0068855_1001516491 345
57 3300005577 Ga0068857_100255145 Ga0068857_1002551452 345
58 3300005614 Ga0068856_100286821 Ga0068856_1002868212 345
59 3300005614 Ga0068856_100354747 Ga0068856_1003547471 345
60 3300005616 Ga0068852_100165849 Ga0068852_1001658492 345
61 3300005616 Ga0068852_100361552 Ga0068852_1003615521 345
62 3300005834 Ga0068851_10104947 Ga0068851_101049472 345
63 3300009093 Ga0105240_10248820 Ga0105240_102488202 345
64 3300009174 Ga0105241_10073806 Ga0105241_100738061 345
65 3300009545 Ga0105237_10158634 Ga0105237_101586342 345
66 3300009551 Ga0105238_10093436 Ga0105238_100934362 345
67 3300010375 Ga0105239_10431281 Ga0105239_104312811 345
68 3300013100 Ga0157373_10132934 Ga0157373_101329342 345
69 3300013104 Ga0157370_10207151 Ga0157370_102071512 345
70 3300013105 Ga0157369_10340820 Ga0157369_103408201 345
71 3300013307 Ga0157372_10525655 Ga0157372_105256551 345
72 3300020070 Ga0206356_11893423 Ga0206356_118934231 345
73 3300025321 Ga0207656_10112256 Ga0207656_101122561 345
74 3300025911 Ga0207654_10044073 Ga0207654_100440732 345
75 3300025912 Ga0207707_10309139 Ga0207707_103091391 345
76 3300025913 Ga0207695_10402282 Ga0207695_104022821 345
77 3300025914 Ga0207671_10305766 Ga0207671_103057661 345
78 3300025921 Ga0207652_10385013 Ga0207652_103850131 345
79 3300025924 Ga0207694_10334203 Ga0207694_103342031 345
80 3300025944 Ga0207661_10392411 Ga0207661_103924111 345
81 3300025949 Ga0207667_10482597 Ga0207667_104825971 345
82 3300025981 Ga0207640_10322670 Ga0207640_103226701 345
83 3300026041 Ga0207639_10362907 Ga0207639_103629072 345
84 3300026041 Ga0207639_10394047 Ga0207639_103940471 345
85 3300026078 Ga0207702_10444739 Ga0207702_104447391 345
86 3300026078 Ga0207702_10453783 Ga0207702_104537831 345
87 3300026116 Ga0207674_10518301 Ga0207674_105183011 345
88 3300026142 Ga0207698_10378928 Ga0207698_103789281 345
89 3300028379 Ga0268266_10120912 Ga0268266_101209121 345
90 3300037418 Ga0395900_0490688 Ga0395900_0490688_22_1062 345
91 3300060353 Ga0501082_0141006 Ga0501082_0141006_228_1265 345
92 3300005336 Ga0070680_100334034 Ga0070680_1003340341 346
93 3300005436 Ga0070713_100399748 Ga0070713_1003997481 346
94 3300005458 Ga0070681_10354597 Ga0070681_103545971 346
95 3300006844 Ga0075428_100308540 Ga0075428_1003085403 346
96 3300006880 Ga0075429_100072909 Ga0075429_1000729093 346
97 3300006880 Ga0075429_100407704 Ga0075429_1004077041 346
98 3300009093 Ga0105240_10558836 Ga0105240_105588361 346
99 3300025928 Ga0207700_10373299 Ga0207700_103732991 346
100 3300031595 Ga0265313_10094013 Ga0265313_100940132 346
101 3300031712 Ga0265342_10120540 Ga0265342_101205402 346
102 3300031728 Ga0316578_10154686 Ga0316578_101546861 346
103 3300005331 Ga0070670_100229229 Ga0070670_1002292292 347
104 3300005344 Ga0070661_100162860 Ga0070661_1001628602 347
105 3300005354 Ga0070675_100196112 Ga0070675_1001961122 347
106 3300005435 Ga0070714_100348215 Ga0070714_1003482151 347
107 3300005564 Ga0070664_100246600 Ga0070664_1002466002 347
108 3300005614 Ga0068856_100437186 Ga0068856_1004371862 347
109 3300005618 Ga0068864_100330456 Ga0068864_1003304561 347
110 3300005840 Ga0068870_10108127 Ga0068870_101081272 347
111 3300005841 Ga0068863_100426250 Ga0068863_1004262501 347
112 3300006237 Ga0097621_100339419 Ga0097621_1003394191 347
113 3300006358 Ga0068871_100334547 Ga0068871_1003345472 347
114 3300006852 Ga0075433_10462980 Ga0075433_104629801 347
115 3300013307 Ga0157372_10038389 Ga0157372_100383896 347
116 3300025908 Ga0207643_10072538 Ga0207643_100725382 347
117 3300025920 Ga0207649_10260994 Ga0207649_102609941 347
118 3300025925 Ga0207650_10197204 Ga0207650_101972041 347
119 3300025926 Ga0207659_10339656 Ga0207659_103396561 347
120 3300025945 Ga0207679_10137420 Ga0207679_101374202 347
121 3300026088 Ga0207641_10400911 Ga0207641_104009111 347
122 3300026095 Ga0207676_10257676 Ga0207676_102576762 347
123 3300031344 Ga0265316_10143111 Ga0265316_101431112 347
124 3300031727 Ga0316576_10132198 Ga0316576_101321982 347
125 3300044684 Ga0466966_0171230 Ga0466966_0171230_167_1270 347
126 3300044712 Ga0453684_0267726 Ga0453684_0267726_606_1649 347
127 3300045049 Ga0466959_0222429 Ga0466959_0222429_29_1081 347
128 3300046492 Ga0495585_0153085 Ga0495585_0153085_14_1063 347
129 3300046537 Ga0495598_0027789 Ga0495598_0027789_274_1323 347
130 3300046558 Ga0495633_0079294 Ga0495633_0079294_228_1277 347
131 3300028800 Ga0265338_10252385 Ga0265338_102523851 348
132 3300029957 Ga0265324_10045734 Ga0265324_100457342 348
133 3300031241 Ga0265325_10003607 Ga0265325_1000360712 348
134 3300031249 Ga0265339_10103872 Ga0265339_101038722 348
135 3300031250 Ga0265331_10003148 Ga0265331_100031482 348
136 3300031595 Ga0265313_10010244 Ga0265313_100102446 348
137 3300044656 Ga0466969_0026101 Ga0466969_0026101_1800_2867 348
138 3300044658 Ga0466972_0082071 Ga0466972_0082071_231_1298 348
139 3300044693 Ga0466961_0162390 Ga0466961_0162390_147_1214 348
140 3300044735 Ga0466968_0068641 Ga0466968_0068641_210_1277 348
141 3300006852 Ga0075433_10269972 Ga0075433_102699722 349
142 3300006871 Ga0075434_100188228 Ga0075434_1001882281 349
143 3300036712 Ga0316584_0223376 Ga0316584_0223376_81_1208 349
144 3300005563 Ga0068855_100459172 Ga0068855_1004591721 350
145 3300005577 Ga0068857_100383099 Ga0068857_1003830991 350
146 3300009177 Ga0105248_10527578 Ga0105248_105275781 350
147 3300013102 Ga0157371_10193234 Ga0157371_101932342 350
148 3300013105 Ga0157369_10465190 Ga0157369_104651902 350
149 3300013307 Ga0157372_10255948 Ga0157372_102559481 350
150 3300013307 Ga0157372_10609868 Ga0157372_106098682 350
151 3300025949 Ga0207667_10147372 Ga0207667_101473722 350
152 3300026142 Ga0207698_10544219 Ga0207698_105442191 350
153 3300045051 Ga0451576_0351932 Ga0451576_0351932_309_1367 350
154 3300050508 nmdc:mga09592_140600_c1 nmdc:mga09592_140600_c1_215_1267 350
155 3300050510 nmdc:mga06r32_511174_c1 nmdc:mga06r32_511174_c1_101_1153 350
156 3300031251 Ga0265327_10084975 Ga0265327_100849752 351
157 3300005329 Ga0070683_100176889 Ga0070683_1001768892 353
158 3300006358 Ga0068871_100302384 Ga0068871_1003023841 353
159 3300006846 Ga0075430_100327818 Ga0075430_1003278181 353
160 3300006847 Ga0075431_100447615 Ga0075431_1004476151 353
161 3300006880 Ga0075429_100341621 Ga0075429_1003416212 353
162 3300009098 Ga0105245_10044875 Ga0105245_100448754 353
163 3300009176 Ga0105242_10189918 Ga0105242_101899181 353
164 3300013296 Ga0157374_10346367 Ga0157374_103463671 353
165 3300013297 Ga0157378_10417159 Ga0157378_104171591 353
166 3300013308 Ga0157375_10578900 Ga0157375_105789001 353
167 3300014969 Ga0157376_10347601 Ga0157376_103476011 353
168 3300025927 Ga0207687_10044819 Ga0207687_100448193 353
169 3300025927 Ga0207687_10160937 Ga0207687_101609371 353

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13358

DDE_3

DDE superfamily endonuclease

207

353

0.96

PF13518

HTH_28

Helix-turn-helix domain

58

107

0.94

PF13384

HTH_23

Homeodomain-like domain

53

102

0.9

PF13565

HTH_32

Homeodomain-like domain

85

165

0.9

PF13551

HTH_29

Winged helix-turn helix

59

116

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vqq-assembly1.cif.gz_B hiv-1 integrase core domain in complex with 2,1,3-benzothiadiazol-4-amine 0.7429 180 339
3l3u-assembly1.cif.gz_B crystal structure of the hiv-1 integrase core domain to 1.4a 0.7402 180 339
6u8q-assembly1.cif.gz_O cryoem structure of hiv-1 cleaved synaptic complex (csc) intasome 0.7395 219 338
1biz-assembly1.cif.gz_A hiv-1 integrase core domain 0.7383 180 339
3vq7-assembly1.cif.gz_B hiv-1 in core domain in complex with 4-(1h-pyrrol-1-yl)aniline 0.7365 180 339
ID Description Score Start End Superfamily
af_Q21972_79_144_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8668 25 72 1.10.10.10
af_Q2FUX5_1_64_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8473 89 144 1.10.10.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8176 176 333 3.30.420.10
af_P19769_115_278_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7863 180 336 3.30.420.10
1ex4A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7634 220 339 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A1Q5VLA2-F1-model_v4 deleted 0.9832 182 336
AF-A0A076LKA2-F1-model_v4 Transposase 0.9698 168 336 GO:0003676
AF-A0A4Q5Y6Y8-F1-model_v4 deleted 0.9689 189 343
AF-A0A3Q9E9G9-F1-model_v4 deleted 0.9682 168 336
AF-A0A4P0XJQ9-F1-model_v4 Transposase 0.9662 168 336 GO:0003676
GO:0009289
GO:0043709

Feature Viewer

pLDDT pTM Quality
86.45 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map