F254740

General Info

Members Datasets Scaffolds Average Seq Length
169 135 119 248

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10082345|Ga0157374_100823454
Length 267
Sequence LQASIFPETERTIPLIFDKFNLKGKVALVTGSSRGLGEAIAMALAEAGANLAVHGSSQPPADTQERVAKTGVDCIALAGDVGDVDVCARLVEETVGHFGTIDILVNNAGIIRRSPAVDHPEEDWKAIIDVNLSSVFRLTQHAGRHMIAKGYGKIINIASLLTFQGGILVPSYAAAKGGVGQLTKAFANEWASKGVNVNAIAPGYFATDNTEALQKDPERSRQIMERIPAGRWGDPEDLGGAAVFLASAASDYVHGHILVIDGGWLNR

Samples

Sample ID Description Type Environment
1 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
2 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
3 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
4 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
5 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
6 2671180694 Paenibacillus sp. A3 Isolate Unclassified
7 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
8 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
9 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
10 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
11 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
12 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
13 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
14 2860837431 Bacillus sp. WR11 Isolate Unclassified
15 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
16 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
17 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
18 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
19 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
20 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
21 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
22 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
23 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
24 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
25 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
26 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
27 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
28 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
29 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
30 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
31 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
32 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
33 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
34 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
35 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
36 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
37 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
38 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
39 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
40 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
41 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
42 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
43 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
44 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
111 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
112 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
113 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
131 8022653035 Bacillus sp. Rc4 Isolate Unclassified
132 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
133 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
134 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
135 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 69.23
Metatranscriptomes 1.18
Isolates 29.59

Biome Distribution

Category Percentage (%)
Aerial Root 1.78
Bulb 0
Endosphere 2.96
Nodule 0.59
Rhizoplane 0
Rhizosphere 72.78
Stem 0
Stem Tuber 0
Unclassified 21.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055538_1000232 3300003751 Bacteria 31057
2 Ga0065704_10070263 3300005289 Bacteria 45238
3 Ga0070658_10008815 3300005327 Bacteria 8108
4 Ga0070683_100108881 3300005329 Bacteria 2613
5 Ga0070680_100096937 3300005336 Bacteria 2445
6 Ga0070659_100158271 3300005366 Bacteria 1851
7 Ga0070713_100075440 3300005436 Bacteria 2860
8 Ga0070710_10061821 3300005437 Bacteria 2134
9 Ga0070681_10009123 3300005458 Bacteria 9746
10 Ga0070679_100101833 3300005530 Bacteria 2858
11 Ga0070679_100306111 3300005530 Bacteria 1539
12 Ga0070684_100494462 3300005535 Bacteria 1133
13 Ga0068855_100010944 3300005563 Bacteria 10950
14 Ga0068857_100204758 3300005577 Bacteria 1799
15 Ga0068856_100602796 3300005614 Bacteria 1119
16 Ga0068852_100007325 3300005616 Bacteria 8049
17 Ga0070712_100124441 3300006175 Bacteria 1945
18 Ga0070712_100126964 3300006175 Bacteria 1928
19 Ga0075430_100220531 3300006846 Bacteria 1573
20 Ga0075436_100003805 3300006914 Bacteria 10353
21 Ga0105251_10010875 3300009011 Bacteria 5240
22 Ga0105244_10041764 3300009036 Bacteria 2375
23 Ga0105244_10070734 3300009036 Bacteria 1740
24 Ga0105240_10011582 3300009093 Bacteria 12271
25 Ga0105238_10008512 3300009551 Bacteria 10269
26 Ga0157371_10100659 3300013102 Bacteria 2050
27 Ga0157370_10338716 3300013104 Bacteria 1386
28 Ga0157374_10082345 3300013296 Bacteria 3055
29 Ga0163162_10259323 3300013306 Bacteria 1870
30 Ga0157372_10001132 3300013307 Bacteria 28947
31 Ga0163163_10013877 3300014325 Bacteria 7389
32 Ga0163161_10000651 3300017792 Bacteria 27719
33 Ga0206353_11158319 3300020082 Bacteria 4137
34 Ga0209784_100092 3300025224 Bacteria 116472
35 Ga0209566_101726 3300025225 Bacteria 5288
36 Ga0209437_100612 3300025233 Bacteria 21891
37 Ga0209025_1011887 3300025294 Bacteria 5666
38 Ga0207707_10003239 3300025912 Bacteria 14458
39 Ga0207695_10002288 3300025913 Bacteria 28621
40 Ga0207693_10274665 3300025915 Bacteria 1320
41 Ga0207660_10020772 3300025917 Bacteria 4412
42 Ga0207660_10155428 3300025917 Bacteria 1760
43 Ga0207660_10303776 3300025917 Bacteria 1271
44 Ga0207652_10186660 3300025921 Bacteria 1864
45 Ga0207694_10121594 3300025924 Bacteria 2085
46 Ga0207700_10068374 3300025928 Bacteria 2723
47 Ga0207690_10148102 3300025932 Bacteria 1738
48 Ga0207661_10205084 3300025944 Bacteria 1735
49 Ga0207667_10000934 3300025949 Bacteria 37249
50 Ga0207678_10050689 3300026067 Bacteria 3586
51 Ga0207702_10052316 3300026078 Bacteria 3455
52 Ga0207702_10647913 3300026078 Bacteria 1039
53 Ga0207674_10066886 3300026116 Bacteria 3619
54 Ga0265337_1005116 3300028556 Bacteria 5277
55 Ga0265326_10012255 3300028558 Unclassified 2522
56 Ga0265319_1002169 3300028563 Bacteria 10954
57 Ga0265334_10023875 3300028573 Bacteria 2484
58 Ga0265318_10023366 3300028577 Unclassified 2464
59 Ga0265336_10000152 3300028666 Bacteria 49208
60 Ga0265338_10000295 3300028800 Bacteria 89990
61 Ga0265338_10343899 3300028800 Bacteria 1074
62 Ga0265338_10437014 3300028800 Bacteria 928
63 Ga0265324_10017296 3300029957 Unclassified 2623
64 Ga0265762_1010300 3300030760 Bacteria 1670
65 Ga0265330_10000553 3300031235 Bacteria 24422
66 Ga0265332_10018449 3300031238 Bacteria 3079
67 Ga0265320_10001189 3300031240 Bacteria 19143
68 Ga0265320_10212666 3300031240 Bacteria 862
69 Ga0265325_10000902 3300031241 Bacteria 21454
70 Ga0265325_10019854 3300031241 Unclassified 3710
71 Ga0265325_10100830 3300031241 Bacteria 1413
72 Ga0265340_10005544 3300031247 Bacteria 6997
73 Ga0265340_10009332 3300031247 Bacteria 5270
74 Ga0265340_10025612 3300031247 Bacteria 2986
75 Ga0265340_10049561 3300031247 Unclassified 2039
76 Ga0265339_10002009 3300031249 Bacteria 14947
77 Ga0265339_10008151 3300031249 Bacteria 6686
78 Ga0265316_10003363 3300031344 Bacteria 16217
79 Ga0265316_10033782 3300031344 Bacteria 4161
80 Ga0265316_10088491 3300031344 Unclassified 2364
81 Ga0265316_10089959 3300031344 Bacteria 2342
82 Ga0265316_10123112 3300031344 Bacteria 1957
83 Ga0265313_10000410 3300031595 Bacteria 46063
84 Ga0265313_10001252 3300031595 Bacteria 24181
85 Ga0265313_10024436 3300031595 Unclassified 3227
86 Ga0265314_10148552 3300031711 Bacteria 1440
87 Ga0265342_10002756 3300031712 Bacteria 14924
88 Ga0265342_10002778 3300031712 Bacteria 14826
89 Ga0265342_10009043 3300031712 Bacteria 7069
90 Ga0265342_10042813 3300031712 Unclassified 2734
91 Ga0265342_10141646 3300031712 Bacteria 1341
92 Ga0316576_10369888 3300031727 Bacteria 1065
93 Ga0316212_1003409 3300033547 Bacteria 2296
94 Ga0316582_0061066 3300036647 Bacteria 2417
95 Ga0400489_74068 3300039093 Bacteria 1922
96 Ga0436363_0612684 3300039450 Unclassified 821
97 Ga0451839_0660167 3300041496 Bacteria 874
98 Ga0453684_0057596 3300044712 Bacteria 5027
99 Ga0451576_0787368 3300045051 Bacteria 999
100 Ga0495642_0154121 3300046528 Unclassified 995
101 Ga0495669_0027119 3300046684 Bacteria 2505
102 Ga0495670_0025630 3300046691 Bacteria 2917
103 Ga0496116_0015004 3300048919 Bacteria 6146
104 Ga0496116_0120165 3300048919 Bacteria 1523
105 Ga0496116_0195591 3300048919 Bacteria 1065
106 Ga0496116_0239117 3300048919 Bacteria 914
107 Ga0496119_0135458 3300048922 Bacteria 1336
108 Ga0496121_0148379 3300048924 Bacteria 1729
109 Ga0496121_0248294 3300048924 Bacteria 1235
110 Ga0496122_0027485 3300048925 Bacteria 4862
111 Ga0496122_0066025 3300048925 Bacteria 2618
112 Ga0496122_0096909 3300048925 Bacteria 1987
113 Ga0496123_0138266 3300048926 Bacteria 1337
114 Ga0496123_0246954 3300048926 Bacteria 883
115 Ga0496124_0062333 3300048927 Bacteria 3121
116 Ga0496124_0125599 3300048927 Bacteria 2044
117 Ga0496125_0002722 3300048928 Bacteria 22455
118 Ga0496126_0028898 3300048929 Bacteria 5274
119 nmdc:mga0qj67_241716_c1 3300050509 Bacteria 1465

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0239117 Ga0496116_0239117_283_897 202
2 3300006914 Ga0075436_100003805 Ga0075436_1000038056 206
3 3300031344 Ga0265316_10123112 Ga0265316_101231122 206
4 3300031712 Ga0265342_10141646 Ga0265342_101416462 206
5 3300031249 Ga0265339_10002009 Ga0265339_1000200915 213
6 3300031595 Ga0265313_10000410 Ga0265313_1000041029 213
7 3300031712 Ga0265342_10002778 Ga0265342_1000277815 213
8 3300006175 Ga0070712_100126964 Ga0070712_1001269642 215
9 3300048926 Ga0496123_0138266 Ga0496123_0138266_230_985 219
10 3300031711 Ga0265314_10148552 Ga0265314_101485522 220
11 3300005436 Ga0070713_100075440 Ga0070713_1000754403 224
12 3300025915 Ga0207693_10274665 Ga0207693_102746652 224
13 3300025928 Ga0207700_10068374 Ga0207700_100683743 224
14 3300028573 Ga0265334_10023875 Ga0265334_100238752 225
15 3300005535 Ga0070684_100494462 Ga0070684_1004944622 226
16 3300005614 Ga0068856_100602796 Ga0068856_1006027962 226
17 3300026078 Ga0207702_10647913 Ga0207702_106479132 226
18 3300045051 Ga0451576_0787368 Ga0451576_0787368_281_967 226
19 3300005530 Ga0070679_100101833 Ga0070679_1001018333 227
20 3300025917 Ga0207660_10155428 Ga0207660_101554283 227
21 3300031235 Ga0265330_10000553 Ga0265330_100005536 227
22 3300031241 Ga0265325_10000902 Ga0265325_1000090213 227
23 3300031249 Ga0265339_10008151 Ga0265339_100081513 227
24 3300031344 Ga0265316_10003363 Ga0265316_1000336310 227
25 3300031595 Ga0265313_10001252 Ga0265313_1000125212 227
26 3300031712 Ga0265342_10002756 Ga0265342_100027569 227
27 3300006175 Ga0070712_100124441 Ga0070712_1001244412 228
28 3300041496 Ga0451839_0660167 Ga0451839_0660167_26_790 228
29 3300046691 Ga0495670_0025630 Ga0495670_0025630_1603_2313 228
30 3300013306 Ga0163162_10259323 Ga0163162_102593232 229
31 3300044712 Ga0453684_0057596 Ga0453684_0057596_2539_3294 229
32 3300005327 Ga0070658_10008815 Ga0070658_100088157 230
33 3300005336 Ga0070680_100096937 Ga0070680_1000969372 230
34 3300005366 Ga0070659_100158271 Ga0070659_1001582712 230
35 3300005458 Ga0070681_10009123 Ga0070681_100091233 230
36 3300005563 Ga0068855_100010944 Ga0068855_1000109443 230
37 3300009093 Ga0105240_10011582 Ga0105240_100115821 230
38 3300009551 Ga0105238_10008512 Ga0105238_100085128 230
39 3300013104 Ga0157370_10338716 Ga0157370_103387162 230
40 3300013307 Ga0157372_10001132 Ga0157372_1000113211 230
41 3300025912 Ga0207707_10003239 Ga0207707_100032398 230
42 3300025913 Ga0207695_10002288 Ga0207695_1000228829 230
43 3300025917 Ga0207660_10020772 Ga0207660_100207723 230
44 3300025924 Ga0207694_10121594 Ga0207694_101215942 230
45 3300025932 Ga0207690_10148102 Ga0207690_101481022 230
46 3300025949 Ga0207667_10000934 Ga0207667_1000093428 230
47 3300026078 Ga0207702_10052316 Ga0207702_100523163 230
48 3300030760 Ga0265762_1010300 Ga0265762_10103002 230
49 3300031247 Ga0265340_10005544 Ga0265340_100055444 230
50 3300028556 Ga0265337_1005116 Ga0265337_10051166 231
51 3300028558 Ga0265326_10012255 Ga0265326_100122553 231
52 3300028563 Ga0265319_1002169 Ga0265319_100216910 231
53 3300028577 Ga0265318_10023366 Ga0265318_100233663 231
54 3300028666 Ga0265336_10000152 Ga0265336_100001522 231
55 3300028800 Ga0265338_10000295 Ga0265338_1000029577 231
56 3300029957 Ga0265324_10017296 Ga0265324_100172963 231
57 3300031238 Ga0265332_10018449 Ga0265332_100184493 231
58 3300031240 Ga0265320_10001189 Ga0265320_1000118916 231
59 3300031241 Ga0265325_10019854 Ga0265325_100198545 231
60 3300031247 Ga0265340_10049561 Ga0265340_100495612 231
61 3300031344 Ga0265316_10088491 Ga0265316_100884912 231
62 3300031595 Ga0265313_10024436 Ga0265313_100244362 231
63 3300031712 Ga0265342_10042813 Ga0265342_100428133 231
64 3300033547 Ga0316212_1003409 Ga0316212_10034093 231
65 3300028800 Ga0265338_10437014 Ga0265338_104370141 232
66 3300031712 Ga0265342_10009043 Ga0265342_100090434 232
67 3300031241 Ga0265325_10100830 Ga0265325_101008301 235
68 3300031247 Ga0265340_10009332 Ga0265340_100093323 235
69 3300031344 Ga0265316_10089959 Ga0265316_100899593 235
70 3300017792 Ga0163161_10000651 Ga0163161_1000065115 236
71 3300005289 Ga0065704_10070263 Ga0065704_100702632 237
72 3300028800 Ga0265338_10343899 Ga0265338_103438991 237
73 3300031247 Ga0265340_10025612 Ga0265340_100256123 237
74 3300031344 Ga0265316_10033782 Ga0265316_100337823 237
75 3300048927 Ga0496124_0125599 Ga0496124_0125599_1285_1998 237
76 3300025294 Ga0209025_1011887 Ga0209025_10118874 238
77 iso_pu_bacteria 8055531788 8055537207 238
78 3300006846 Ga0075430_100220531 Ga0075430_1002205312 240
79 3300048919 Ga0496116_0195591 Ga0496116_0195591_20_763 240
80 3300050509 nmdc:mga0qj67_241716_c1 nmdc:mga0qj67_241716_c1_576_1349 240
81 3300005329 Ga0070683_100108881 Ga0070683_1001088812 243
82 3300005437 Ga0070710_10061821 Ga0070710_100618211 243
83 3300005530 Ga0070679_100306111 Ga0070679_1003061112 243
84 3300005577 Ga0068857_100204758 Ga0068857_1002047582 243
85 3300020082 Ga0206353_11158319 Ga0206353_111583192 243
86 3300025917 Ga0207660_10303776 Ga0207660_103037762 243
87 3300025921 Ga0207652_10186660 Ga0207652_101866602 243
88 3300025944 Ga0207661_10205084 Ga0207661_102050842 243
89 3300026067 Ga0207678_10050689 Ga0207678_100506893 243
90 3300026116 Ga0207674_10066886 Ga0207674_100668862 243
91 3300039093 Ga0400489_74068 Ga0400489_74068_288_1049 243
92 iso_pu_bacteria 2540341094 2540607148 243
93 iso_pu_bacteria 2808606399 2809056689 243
94 iso_pu_bacteria 2860837431 2860839829 243
95 iso_pu_bacteria 2962290636 2962293099 243
96 iso_pu_bacteria 2969136845 2969139110 243
97 iso_pu_bacteria 2969765954 2969767074 243
98 iso_pu_bacteria 2969770375 2969773609 243
99 iso_pu_bacteria 2980492589 2980494844 243
100 iso_pu_bacteria 2984527788 2984531046 243
101 iso_pu_bacteria 2984532647 2984537155 243
102 iso_pu_bacteria 8022653035 8022657339 243
103 iso_pu_bacteria 8057977335 8057977726 243
104 3300005616 Ga0068852_100007325 Ga0068852_1000073257 244
105 3300013296 Ga0157374_10082345 Ga0157374_100823454 244
106 3300014325 Ga0163163_10013877 Ga0163163_100138774 244
107 3300039450 Ga0436363_0612684 Ga0436363_0612684_31_780 244
108 3300046528 Ga0495642_0154121 Ga0495642_0154121_145_906 244
109 3300046684 Ga0495669_0027119 Ga0495669_0027119_303_1064 244
110 iso_pu_bacteria 2512564039 2512729972 244
111 iso_pu_bacteria 2989776772 2989777536 244
112 3300031240 Ga0265320_10212666 Ga0265320_102126661 245
113 3300031727 Ga0316576_10369888 Ga0316576_103698881 245
114 3300036647 Ga0316582_0061066 Ga0316582_0061066_383_1147 246
115 iso_pu_bacteria 2643221543 2643740899 250
116 iso_pu_bacteria 2721755693 2723605777 250
117 iso_pu_bacteria 2728369359 2730136451 250
118 iso_pu_bacteria 2751185905 2753810411 250
119 iso_pu_bacteria 2802428803 2802438627 250
120 iso_pu_bacteria 2889276214 2889276293 250
121 iso_pu_bacteria 2904595352 2904598923 250
122 iso_pu_bacteria 2939679117 2939683974 250
123 iso_pu_bacteria 2939702853 2939704297 250
124 iso_pu_bacteria 2996706504 2996711659 250
125 iso_pu_bacteria 648028048 648171821 251
126 iso_pu_bacteria 2984527788 2984530899 252
127 iso_pu_bacteria 2821111986 2821117379 253
128 iso_pu_bacteria 2885526491 2885533005 253
129 iso_pu_bacteria 2889042446 2889047649 253
130 iso_pu_bacteria 2904162308 2904162407 253
131 iso_pu_bacteria 2904490793 2904495558 253
132 iso_pu_bacteria 2907202186 2907207596 253
133 iso_pu_bacteria 2919160200 2919164558 253
134 iso_pu_bacteria 2931384279 2931384700 253
135 iso_pu_bacteria 2945991243 2945996642 253
136 iso_pu_bacteria 2946053406 2946059321 253
137 3300009011 Ga0105251_10010875 Ga0105251_100108757 254
138 3300009036 Ga0105244_10041764 Ga0105244_100417643 254
139 3300013102 Ga0157371_10100659 Ga0157371_101006593 254
140 3300048919 Ga0496116_0015004 Ga0496116_0015004_4488_5258 254
141 3300048922 Ga0496119_0135458 Ga0496119_0135458_38_805 254
142 3300048924 Ga0496121_0148379 Ga0496121_0148379_580_1347 254
143 3300048924 Ga0496121_0248294 Ga0496121_0248294_383_1150 254
144 3300048925 Ga0496122_0027485 Ga0496122_0027485_379_1149 254
145 3300048925 Ga0496122_0096909 Ga0496122_0096909_559_1323 254
146 3300048926 Ga0496123_0246954 Ga0496123_0246954_48_818 254
147 3300048927 Ga0496124_0062333 Ga0496124_0062333_1112_1879 254
148 3300048928 Ga0496125_0002722 Ga0496125_0002722_2803_3570 254
149 3300048929 Ga0496126_0028898 Ga0496126_0028898_223_990 254
150 iso_pu_bacteria 2524023129 2524190608 254
151 iso_pu_bacteria 2864997549 2865000329 254
152 iso_pu_bacteria 2593339198 2595319567 255
153 iso_pu_bacteria 2671180694 2673823202 255
154 iso_pu_bacteria 2857453340 2857458027 255
155 iso_pu_bacteria 2889295896 2889298087 255
156 iso_pu_bacteria 2971410472 2971413473 255
157 iso_pu_bacteria 2981284811 2981286569 255
158 iso_pu_bacteria 2981289755 2981291520 255
159 iso_pu_bacteria 2981980479 2981982212 255
160 iso_pu_bacteria 2981985349 2981987113 255
161 iso_pu_bacteria 8054795415 8054797966 255
162 iso_pu_bacteria 8056533031 8056535779 255
163 3300003751 Ga0055538_1000232 Ga0055538_100023235 257
164 3300009036 Ga0105244_10070734 Ga0105244_100707341 257
165 3300025224 Ga0209784_100092 Ga0209784_10009271 257
166 3300025225 Ga0209566_101726 Ga0209566_1017264 257
167 3300025233 Ga0209437_100612 Ga0209437_1006129 257
168 3300048919 Ga0496116_0120165 Ga0496116_0120165_25_828 257
169 3300048925 Ga0496122_0066025 Ga0496122_0066025_625_1413 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

25

218

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

31

265

0.95

PF08659

KR

KR domain

25

207

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cdy-assembly1.cif.gz_C the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9313 2 245
3rkr-assembly1.cif.gz_A-2 crystal structure of a metagenomic short-chain oxidoreductase (sdr) in complex with nadp 0.9288 1 243
3edm-assembly1.cif.gz_C crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.9245 1 245
3edm-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.9233 2 243
3v2h-assembly1.cif.gz_A the crystal structure of d-beta-hydroxybutyrate dehydrogenase from sinorhizobium meliloti 0.9209 2 245
ID Description Score Start End Superfamily
3rkrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9288 1 243 3.40.50.720
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9276 1 248 3.40.50.720
3qivB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9205 2 243 3.40.50.720
5k9zA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9187 1 243 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.918 2 79 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A841EYW3-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9682 1 178
AF-A0A814FF15-F1-model_v4 Uncharacterized protein 0.9494 1 141 GO:0016614
AF-A0A841EYW3-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9422 1 178
AF-A0A4U3BJ09-F1-model_v4 deleted 0.9378 4 192
AF-A0A2D9Z3F2-F1-model_v4 3-ketoacyl-ACP reductase 0.9351 1 139

Feature Viewer

pLDDT pTM Quality
86.16 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map