F254728
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 169 | 129 | 169 | 328 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10002261|Ga0157370_1000226116 |
| Length | 352 |
| Sequence | LEFPAQAHKEPERIARVSDTDAYAKAGVDQGAADSAVAGLVRALAAIELGRPSRQVPLPGHYASVIELDERTGIALSTDGVGTKLLVAEELGRFDTVGIDCVAMNVNDVICVGAEPLAMLDYIAIERADPGVCAQIGVGLARGAELAGIEIPGGELAQLGDMVRGFDIAGACFGTVALDAIVDGSAVRPGDPIVGLPSSGIHSNGYTLARSALDGLPLGEDPEARLGRPLGDVLLEPTEIYVKPVMELLRSDIEVRGLAHITSGGLGNLLRLAAPVGYEIDDPLPVPPIFELIQERAAVPDAEMRDVFNMGCGFCLVVAPDDEGAAVESMRRHYPGAKRIGRTVEGSSVRLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 15 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 18 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 19 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 20 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 21 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 22 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 24 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 65 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 66 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 67 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 68 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 100 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 101 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 102 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 103 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 104 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 105 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 106 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 107 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 108 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 109 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 110 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 111 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 112 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 113 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 114 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 115 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 116 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 117 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 118 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 119 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 121 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.59 |
| Nodule | 0 |
| Rhizoplane | 9.47 |
| Rhizosphere | 83.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10004405 | 3300001979 | Bacteria | 6054 |
| 2 | Ga0070683_100042270 | 3300005329 | Bacteria | 4197 |
| 3 | Ga0070683_100068091 | 3300005329 | Bacteria | 3316 |
| 4 | Ga0070677_10000048 | 3300005333 | Bacteria | 37331 |
| 5 | Ga0070666_10020271 | 3300005335 | Bacteria | 4297 |
| 6 | Ga0070682_100000029 | 3300005337 | Bacteria | 183516 |
| 7 | Ga0068868_100129280 | 3300005338 | Bacteria | 2066 |
| 8 | Ga0070674_100000033 | 3300005356 | Bacteria | 63982 |
| 9 | Ga0070674_100000148 | 3300005356 | Bacteria | 32680 |
| 10 | Ga0070673_100000245 | 3300005364 | Bacteria | 27379 |
| 11 | Ga0070711_100002185 | 3300005439 | Bacteria | 11104 |
| 12 | Ga0070663_100000641 | 3300005455 | Bacteria | 18754 |
| 13 | Ga0070663_100334969 | 3300005455 | Bacteria | 1221 |
| 14 | Ga0070662_100000008 | 3300005457 | Bacteria | 168754 |
| 15 | Ga0070679_100000823 | 3300005530 | Bacteria | 26958 |
| 16 | Ga0070679_100006876 | 3300005530 | Bacteria | 10609 |
| 17 | Ga0070684_100004696 | 3300005535 | Bacteria | 10427 |
| 18 | Ga0070684_100029835 | 3300005535 | Bacteria | 4626 |
| 19 | Ga0068853_100060676 | 3300005539 | Bacteria | 3269 |
| 20 | Ga0070665_100000120 | 3300005548 | Bacteria | 148340 |
| 21 | Ga0070665_100049651 | 3300005548 | Bacteria | 4209 |
| 22 | Ga0070664_100170587 | 3300005564 | Bacteria | 1930 |
| 23 | Ga0068856_100026904 | 3300005614 | Bacteria | 5610 |
| 24 | Ga0068864_100000044 | 3300005618 | Bacteria | 157919 |
| 25 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 26 | Ga0068866_10001369 | 3300005718 | Bacteria | 10515 |
| 27 | Ga0068858_100000035 | 3300005842 | Bacteria | 140466 |
| 28 | Ga0068858_100000042 | 3300005842 | Bacteria | 132482 |
| 29 | Ga0068860_100089860 | 3300005843 | Bacteria | 2925 |
| 30 | Ga0068860_100372430 | 3300005843 | Bacteria | 1409 |
| 31 | Ga0070715_10000015 | 3300006163 | Bacteria | 152816 |
| 32 | Ga0075433_10000031 | 3300006852 | Bacteria | 55735 |
| 33 | Ga0105245_10000150 | 3300009098 | Bacteria | 66121 |
| 34 | Ga0105245_10000327 | 3300009098 | Bacteria | 44888 |
| 35 | Ga0105247_10000712 | 3300009101 | Bacteria | 25919 |
| 36 | Ga0105242_10001663 | 3300009176 | Bacteria | 17592 |
| 37 | Ga0105242_10039069 | 3300009176 | Bacteria | 3819 |
| 38 | Ga0105238_10000240 | 3300009551 | Bacteria | 61138 |
| 39 | Ga0105249_10000095 | 3300009553 | Bacteria | 121300 |
| 40 | Ga0157370_10002261 | 3300013104 | Bacteria | 23404 |
| 41 | Ga0157374_10000668 | 3300013296 | Bacteria | 30198 |
| 42 | Ga0157378_10142551 | 3300013297 | Bacteria | 2226 |
| 43 | Ga0163162_10586221 | 3300013306 | Bacteria | 1242 |
| 44 | Ga0157375_10000723 | 3300013308 | Bacteria | 29095 |
| 45 | Ga0157375_10007412 | 3300013308 | Bacteria | 9606 |
| 46 | Ga0157379_10040447 | 3300014968 | Bacteria | 4161 |
| 47 | Ga0157376_10306715 | 3300014969 | Bacteria | 1505 |
| 48 | Ga0207682_10000168 | 3300025893 | Bacteria | 30073 |
| 49 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 50 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 51 | Ga0207642_10000258 | 3300025899 | Bacteria | 15861 |
| 52 | Ga0207680_10010856 | 3300025903 | Bacteria | 4575 |
| 53 | Ga0207680_10023775 | 3300025903 | Bacteria | 3352 |
| 54 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 55 | Ga0207693_10098970 | 3300025915 | Bacteria | 2287 |
| 56 | Ga0207663_10004223 | 3300025916 | Bacteria | 7122 |
| 57 | Ga0207660_10087851 | 3300025917 | Bacteria | 2298 |
| 58 | Ga0207652_10000544 | 3300025921 | Bacteria | 38182 |
| 59 | Ga0207652_10010414 | 3300025921 | Bacteria | 7486 |
| 60 | Ga0207646_10216877 | 3300025922 | Bacteria | 1728 |
| 61 | Ga0207694_10000067 | 3300025924 | Bacteria | 128108 |
| 62 | Ga0207687_10000021 | 3300025927 | Bacteria | 226396 |
| 63 | Ga0207687_10000099 | 3300025927 | Bacteria | 63345 |
| 64 | Ga0207706_10000016 | 3300025933 | Bacteria | 170697 |
| 65 | Ga0207686_10000189 | 3300025934 | Bacteria | 47718 |
| 66 | Ga0207686_10022217 | 3300025934 | Bacteria | 3652 |
| 67 | Ga0207686_10032431 | 3300025934 | Bacteria | 3109 |
| 68 | Ga0207669_10000014 | 3300025937 | Bacteria | 129145 |
| 69 | Ga0207669_10000024 | 3300025937 | Bacteria | 96123 |
| 70 | Ga0207661_10019425 | 3300025944 | Bacteria | 5066 |
| 71 | Ga0207661_10028800 | 3300025944 | Bacteria | 4258 |
| 72 | Ga0207651_10002099 | 3300025960 | Bacteria | 9408 |
| 73 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 74 | Ga0207640_10007639 | 3300025981 | Bacteria | 5971 |
| 75 | Ga0207658_10004671 | 3300025986 | Bacteria | 9492 |
| 76 | Ga0207677_10000376 | 3300026023 | Bacteria | 30827 |
| 77 | Ga0207703_10000060 | 3300026035 | Bacteria | 134334 |
| 78 | Ga0207703_10000067 | 3300026035 | Bacteria | 125623 |
| 79 | Ga0207639_10044202 | 3300026041 | Bacteria | 3349 |
| 80 | Ga0207678_10001410 | 3300026067 | Bacteria | 22098 |
| 81 | Ga0207702_10198121 | 3300026078 | Bacteria | 1860 |
| 82 | Ga0207648_10000228 | 3300026089 | Bacteria | 60032 |
| 83 | Ga0207676_10000043 | 3300026095 | Bacteria | 161948 |
| 84 | Ga0207683_10058647 | 3300026121 | Bacteria | 3380 |
| 85 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 86 | Ga0268266_10004808 | 3300028379 | Bacteria | 12826 |
| 87 | Ga0268266_10050383 | 3300028379 | Bacteria | 3573 |
| 88 | Ga0373937_0110368 | 3300036401 | Bacteria | 2558 |
| 89 | Ga0395905_0050836 | 3300037471 | Bacteria | 3883 |
| 90 | Ga0395901_0093006 | 3300038443 | Bacteria | 3157 |
| 91 | Ga0466963_0000027 | 3300044694 | Bacteria | 48596 |
| 92 | Ga0495592_0001977 | 3300046454 | Bacteria | 14474 |
| 93 | Ga0495603_0002055 | 3300046455 | Bacteria | 11838 |
| 94 | Ga0495629_0184243 | 3300046459 | Bacteria | 1446 |
| 95 | Ga0495641_0000001 | 3300046461 | Bacteria | 485224 |
| 96 | Ga0495653_0013255 | 3300046463 | Bacteria | 6721 |
| 97 | Ga0495582_0000005 | 3300046473 | Bacteria | 156170 |
| 98 | Ga0495608_0031772 | 3300046511 | Bacteria | 3568 |
| 99 | Ga0495620_0000580 | 3300046515 | Bacteria | 22923 |
| 100 | Ga0495628_0096102 | 3300046516 | Bacteria | 2289 |
| 101 | Ga0495630_0031816 | 3300046517 | Bacteria | 3929 |
| 102 | Ga0495630_0085717 | 3300046517 | Bacteria | 2378 |
| 103 | Ga0495644_0001581 | 3300046523 | Bacteria | 9286 |
| 104 | Ga0495652_0011942 | 3300046529 | Bacteria | 7854 |
| 105 | Ga0495586_0008553 | 3300046535 | Bacteria | 5449 |
| 106 | Ga0495587_0040018 | 3300046536 | Bacteria | 2803 |
| 107 | Ga0495598_0001025 | 3300046537 | Bacteria | 5349 |
| 108 | Ga0495645_0012242 | 3300046543 | Bacteria | 6042 |
| 109 | Ga0495633_0152163 | 3300046558 | Bacteria | 1068 |
| 110 | Ga0495667_0019713 | 3300046559 | Bacteria | 4551 |
| 111 | Ga0495656_0010420 | 3300046615 | Bacteria | 3380 |
| 112 | Ga0495634_0001391 | 3300046642 | Bacteria | 21767 |
| 113 | Ga0495634_0066151 | 3300046642 | Bacteria | 2393 |
| 114 | Ga0495635_0034130 | 3300046663 | Bacteria | 3530 |
| 115 | Ga0495647_0000013 | 3300046681 | Bacteria | 88029 |
| 116 | Ga0495658_0000019 | 3300046683 | Bacteria | 91606 |
| 117 | Ga0495669_0000163 | 3300046684 | Bacteria | 42549 |
| 118 | Ga0495613_0036061 | 3300046689 | Bacteria | 3667 |
| 119 | Ga0495624_0000013 | 3300046690 | Bacteria | 115278 |
| 120 | Ga0495649_0000828 | 3300046694 | Bacteria | 24830 |
| 121 | Ga0495604_0000033 | 3300047317 | Bacteria | 134810 |
| 122 | Ga0495676_0000091 | 3300047321 | Bacteria | 66575 |
| 123 | Ga0495676_0000563 | 3300047321 | Bacteria | 30429 |
| 124 | Ga0495680_0003921 | 3300047322 | Bacteria | 14394 |
| 125 | Ga0495684_0185433 | 3300047471 | Bacteria | 1541 |
| 126 | Ga0496100_0000003 | 3300048903 | Bacteria | 360802 |
| 127 | Ga0496100_0209268 | 3300048903 | Bacteria | 1426 |
| 128 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 129 | Ga0496102_0001497 | 3300048905 | Bacteria | 20646 |
| 130 | Ga0496102_0102944 | 3300048905 | Bacteria | 2655 |
| 131 | Ga0496103_0113362 | 3300048906 | Bacteria | 1723 |
| 132 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 133 | Ga0496105_0000031 | 3300048908 | Bacteria | 137220 |
| 134 | Ga0496106_0000048 | 3300048909 | Bacteria | 98233 |
| 135 | Ga0496107_0000008 | 3300048910 | Bacteria | 251874 |
| 136 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 137 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 138 | Ga0496109_0000237 | 3300048912 | Bacteria | 53743 |
| 139 | Ga0496110_0008421 | 3300048913 | Bacteria | 8299 |
| 140 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 141 | Ga0496114_0035590 | 3300048917 | Bacteria | 4112 |
| 142 | Ga0496116_0000014 | 3300048919 | Bacteria | 569049 |
| 143 | Ga0496117_0002396 | 3300048920 | Bacteria | 23836 |
| 144 | Ga0496118_0001663 | 3300048921 | Bacteria | 32640 |
| 145 | Ga0496118_0094958 | 3300048921 | Bacteria | 2037 |
| 146 | Ga0496118_0169502 | 3300048921 | Bacteria | 1336 |
| 147 | Ga0496119_0000441 | 3300048922 | Bacteria | 56986 |
| 148 | Ga0496120_0007177 | 3300048923 | Bacteria | 8350 |
| 149 | Ga0496121_0006409 | 3300048924 | Bacteria | 14630 |
| 150 | Ga0496121_0036079 | 3300048924 | Bacteria | 4413 |
| 151 | Ga0496126_0041602 | 3300048929 | Bacteria | 4250 |
| 152 | Ga0496126_0047669 | 3300048929 | Bacteria | 3922 |
| 153 | Ga0501047_0046671 | 3300049581 | Bacteria | 4186 |
| 154 | Ga0501047_0242994 | 3300049581 | Bacteria | 1650 |
| 155 | Ga0501069_0033304 | 3300049585 | Bacteria | 2838 |
| 156 | Ga0501071_0052088 | 3300049587 | Bacteria | 2951 |
| 157 | Ga0501079_0015984 | 3300049741 | Bacteria | 5735 |
| 158 | Ga0501080_0019251 | 3300049742 | Bacteria | 6322 |
| 159 | Ga0501083_0032402 | 3300049744 | Bacteria | 3583 |
| 160 | Ga0501083_0050230 | 3300049744 | Bacteria | 2807 |
| 161 | Ga0501083_0106744 | 3300049744 | Bacteria | 1843 |
| 162 | Ga0501044_0035752 | 3300049823 | Bacteria | 5200 |
| 163 | nmdc:mga0a205_9_c1 | 3300050515 | Bacteria | 55726 |
| 164 | Ga0495601_0002736 | 3300053077 | Bacteria | 10019 |
| 165 | Ga0495619_0000129 | 3300053085 | Bacteria | 55936 |
| 166 | Ga0495619_0000192 | 3300053085 | Bacteria | 45153 |
| 167 | Ga0495619_0000909 | 3300053085 | Bacteria | 19385 |
| 168 | Ga0495619_0011588 | 3300053085 | Bacteria | 5555 |
| 169 | Ga0500614_000183 | 3300053123 | Bacteria | 16149 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046689 | Ga0495613_0036061 | Ga0495613_0036061_39_905 | 285 |
| 2 | 3300048929 | Ga0496126_0047669 | Ga0496126_0047669_2207_3184 | 295 |
| 3 | 3300049581 | Ga0501047_0242994 | Ga0501047_0242994_489_1493 | 298 |
| 4 | 3300028379 | Ga0268266_10050383 | Ga0268266_100503833 | 302 |
| 5 | 3300048919 | Ga0496116_0000014 | Ga0496116_0000014_461001_462005 | 302 |
| 6 | 3300048921 | Ga0496118_0094958 | Ga0496118_0094958_268_1272 | 302 |
| 7 | 3300048921 | Ga0496118_0169502 | Ga0496118_0169502_222_1232 | 302 |
| 8 | 3300048922 | Ga0496119_0000441 | Ga0496119_0000441_839_1843 | 302 |
| 9 | 3300048924 | Ga0496121_0006409 | Ga0496121_0006409_6113_7120 | 302 |
| 10 | 3300049581 | Ga0501047_0046671 | Ga0501047_0046671_2459_3463 | 302 |
| 11 | 3300049585 | Ga0501069_0033304 | Ga0501069_0033304_140_1144 | 302 |
| 12 | 3300049587 | Ga0501071_0052088 | Ga0501071_0052088_316_1320 | 302 |
| 13 | 3300049741 | Ga0501079_0015984 | Ga0501079_0015984_4062_5066 | 302 |
| 14 | 3300049742 | Ga0501080_0019251 | Ga0501080_0019251_4498_5502 | 302 |
| 15 | 3300049744 | Ga0501083_0050230 | Ga0501083_0050230_1699_2703 | 302 |
| 16 | 3300049823 | Ga0501044_0035752 | Ga0501044_0035752_4041_5045 | 302 |
| 17 | 3300005335 | Ga0070666_10020271 | Ga0070666_100202712 | 303 |
| 18 | 3300005843 | Ga0068860_100372430 | Ga0068860_1003724302 | 303 |
| 19 | 3300013306 | Ga0163162_10586221 | Ga0163162_105862211 | 303 |
| 20 | 3300014969 | Ga0157376_10306715 | Ga0157376_103067152 | 303 |
| 21 | 3300025903 | Ga0207680_10023775 | Ga0207680_100237753 | 303 |
| 22 | 3300048903 | Ga0496100_0209268 | Ga0496100_0209268_32_1042 | 303 |
| 23 | 3300048905 | Ga0496102_0001497 | Ga0496102_0001497_12559_13566 | 303 |
| 24 | 3300048906 | Ga0496103_0113362 | Ga0496103_0113362_466_1473 | 303 |
| 25 | 3300048920 | Ga0496117_0002396 | Ga0496117_0002396_18636_19643 | 303 |
| 26 | 3300048921 | Ga0496118_0001663 | Ga0496118_0001663_13462_14469 | 303 |
| 27 | 3300048923 | Ga0496120_0007177 | Ga0496120_0007177_3616_4623 | 303 |
| 28 | 3300048924 | Ga0496121_0036079 | Ga0496121_0036079_1275_2279 | 303 |
| 29 | 3300048929 | Ga0496126_0041602 | Ga0496126_0041602_585_1589 | 303 |
| 30 | 3300049744 | Ga0501083_0032402 | Ga0501083_0032402_1872_2882 | 303 |
| 31 | 3300049744 | Ga0501083_0106744 | Ga0501083_0106744_377_1381 | 303 |
| 32 | 3300025915 | Ga0207693_10098970 | Ga0207693_100989703 | 304 |
| 33 | 3300048905 | Ga0496102_0102944 | Ga0496102_0102944_829_1839 | 304 |
| 34 | 3300005457 | Ga0070662_100000008 | Ga0070662_100000008117 | 305 |
| 35 | 3300025933 | Ga0207706_10000016 | Ga0207706_1000001657 | 305 |
| 36 | 3300005548 | Ga0070665_100049651 | Ga0070665_1000496514 | 306 |
| 37 | 3300025903 | Ga0207680_10010856 | Ga0207680_100108562 | 306 |
| 38 | 3300025986 | Ga0207658_10004671 | Ga0207658_100046712 | 306 |
| 39 | 3300028379 | Ga0268266_10004808 | Ga0268266_100048086 | 306 |
| 40 | 3300053085 | Ga0495619_0011588 | Ga0495619_0011588_3873_4883 | 306 |
| 41 | 3300013308 | Ga0157375_10007412 | Ga0157375_100074122 | 310 |
| 42 | 3300046558 | Ga0495633_0152163 | Ga0495633_0152163_94_1038 | 311 |
| 43 | 3300006852 | Ga0075433_10000031 | Ga0075433_1000003116 | 314 |
| 44 | 3300050515 | nmdc:mga0a205_9_c1 | nmdc:mga0a205_9_c1_14034_15053 | 314 |
| 45 | 3300005329 | Ga0070683_100068091 | Ga0070683_1000680911 | 317 |
| 46 | 3300005455 | Ga0070663_100000641 | Ga0070663_10000064117 | 317 |
| 47 | 3300005530 | Ga0070679_100006876 | Ga0070679_1000068763 | 317 |
| 48 | 3300025921 | Ga0207652_10010414 | Ga0207652_100104141 | 317 |
| 49 | 3300025944 | Ga0207661_10019425 | Ga0207661_100194255 | 317 |
| 50 | 3300026067 | Ga0207678_10001410 | Ga0207678_1000141021 | 317 |
| 51 | 3300037471 | Ga0395905_0050836 | Ga0395905_0050836_1033_2034 | 321 |
| 52 | 3300038443 | Ga0395901_0093006 | Ga0395901_0093006_1934_2935 | 321 |
| 53 | 3300046663 | Ga0495635_0034130 | Ga0495635_0034130_664_1665 | 330 |
| 54 | 3300005356 | Ga0070674_100000148 | Ga0070674_1000001485 | 331 |
| 55 | 3300005455 | Ga0070663_100334969 | Ga0070663_1003349691 | 331 |
| 56 | 3300005618 | Ga0068864_100000044 | Ga0068864_100000044105 | 331 |
| 57 | 3300005718 | Ga0068866_10001369 | Ga0068866_100013695 | 331 |
| 58 | 3300005842 | Ga0068858_100000042 | Ga0068858_100000042107 | 331 |
| 59 | 3300009176 | Ga0105242_10039069 | Ga0105242_100390694 | 331 |
| 60 | 3300013104 | Ga0157370_10002261 | Ga0157370_1000226116 | 331 |
| 61 | 3300025899 | Ga0207642_10000258 | Ga0207642_100002582 | 331 |
| 62 | 3300025922 | Ga0207646_10216877 | Ga0207646_102168772 | 331 |
| 63 | 3300025934 | Ga0207686_10022217 | Ga0207686_100222172 | 331 |
| 64 | 3300025934 | Ga0207686_10032431 | Ga0207686_100324312 | 331 |
| 65 | 3300025937 | Ga0207669_10000014 | Ga0207669_1000001497 | 331 |
| 66 | 3300026035 | Ga0207703_10000060 | Ga0207703_1000006029 | 331 |
| 67 | 3300026095 | Ga0207676_10000043 | Ga0207676_10000043104 | 331 |
| 68 | 3300046516 | Ga0495628_0096102 | Ga0495628_0096102_170_1180 | 331 |
| 69 | 3300046559 | Ga0495667_0019713 | Ga0495667_0019713_3181_4191 | 331 |
| 70 | 3300046615 | Ga0495656_0010420 | Ga0495656_0010420_855_1865 | 331 |
| 71 | 3300048912 | Ga0496109_0000237 | Ga0496109_0000237_39774_40784 | 331 |
| 72 | 3300048913 | Ga0496110_0008421 | Ga0496110_0008421_5554_6561 | 331 |
| 73 | 3300053085 | Ga0495619_0000129 | Ga0495619_0000129_44374_45384 | 331 |
| 74 | 3300053085 | Ga0495619_0000192 | Ga0495619_0000192_21788_22804 | 331 |
| 75 | 3300001979 | JGI24740J21852_10004405 | JGI24740J21852_100044055 | 332 |
| 76 | 3300005329 | Ga0070683_100042270 | Ga0070683_1000422703 | 332 |
| 77 | 3300005333 | Ga0070677_10000048 | Ga0070677_100000485 | 332 |
| 78 | 3300005337 | Ga0070682_100000029 | Ga0070682_100000029138 | 332 |
| 79 | 3300005338 | Ga0068868_100129280 | Ga0068868_1001292802 | 332 |
| 80 | 3300005356 | Ga0070674_100000033 | Ga0070674_10000003342 | 332 |
| 81 | 3300005364 | Ga0070673_100000245 | Ga0070673_10000024512 | 332 |
| 82 | 3300005439 | Ga0070711_100002185 | Ga0070711_1000021854 | 332 |
| 83 | 3300005530 | Ga0070679_100000823 | Ga0070679_1000008236 | 332 |
| 84 | 3300005535 | Ga0070684_100004696 | Ga0070684_1000046967 | 332 |
| 85 | 3300005535 | Ga0070684_100029835 | Ga0070684_1000298354 | 332 |
| 86 | 3300005539 | Ga0068853_100060676 | Ga0068853_1000606762 | 332 |
| 87 | 3300005548 | Ga0070665_100000120 | Ga0070665_10000012032 | 332 |
| 88 | 3300005564 | Ga0070664_100170587 | Ga0070664_1001705871 | 332 |
| 89 | 3300005614 | Ga0068856_100026904 | Ga0068856_1000269042 | 332 |
| 90 | 3300005718 | Ga0068866_10000002 | Ga0068866_1000000296 | 332 |
| 91 | 3300005842 | Ga0068858_100000035 | Ga0068858_10000003530 | 332 |
| 92 | 3300005843 | Ga0068860_100089860 | Ga0068860_1000898602 | 332 |
| 93 | 3300006163 | Ga0070715_10000015 | Ga0070715_1000001573 | 332 |
| 94 | 3300009098 | Ga0105245_10000150 | Ga0105245_1000015015 | 332 |
| 95 | 3300009098 | Ga0105245_10000327 | Ga0105245_1000032726 | 332 |
| 96 | 3300009101 | Ga0105247_10000712 | Ga0105247_100007128 | 332 |
| 97 | 3300009176 | Ga0105242_10001663 | Ga0105242_1000166315 | 332 |
| 98 | 3300009551 | Ga0105238_10000240 | Ga0105238_1000024026 | 332 |
| 99 | 3300009553 | Ga0105249_10000095 | Ga0105249_1000009522 | 332 |
| 100 | 3300013296 | Ga0157374_10000668 | Ga0157374_1000066823 | 332 |
| 101 | 3300013297 | Ga0157378_10142551 | Ga0157378_101425512 | 332 |
| 102 | 3300013308 | Ga0157375_10000723 | Ga0157375_100007231 | 332 |
| 103 | 3300014968 | Ga0157379_10040447 | Ga0157379_100404474 | 332 |
| 104 | 3300025893 | Ga0207682_10000168 | Ga0207682_1000016828 | 332 |
| 105 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001512 | 332 |
| 106 | 3300025899 | Ga0207642_10000003 | Ga0207642_10000003512 | 332 |
| 107 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001353 | 332 |
| 108 | 3300025916 | Ga0207663_10004223 | Ga0207663_100042234 | 332 |
| 109 | 3300025917 | Ga0207660_10087851 | Ga0207660_100878512 | 332 |
| 110 | 3300025921 | Ga0207652_10000544 | Ga0207652_100005446 | 332 |
| 111 | 3300025924 | Ga0207694_10000067 | Ga0207694_1000006790 | 332 |
| 112 | 3300025927 | Ga0207687_10000021 | Ga0207687_1000002126 | 332 |
| 113 | 3300025927 | Ga0207687_10000099 | Ga0207687_1000009914 | 332 |
| 114 | 3300025934 | Ga0207686_10000189 | Ga0207686_100001893 | 332 |
| 115 | 3300025937 | Ga0207669_10000024 | Ga0207669_1000002492 | 332 |
| 116 | 3300025944 | Ga0207661_10028800 | Ga0207661_100288002 | 332 |
| 117 | 3300025960 | Ga0207651_10002099 | Ga0207651_100020992 | 332 |
| 118 | 3300025961 | Ga0207712_10000003 | Ga0207712_10000003516 | 332 |
| 119 | 3300025981 | Ga0207640_10007639 | Ga0207640_100076393 | 332 |
| 120 | 3300026023 | Ga0207677_10000376 | Ga0207677_1000037626 | 332 |
| 121 | 3300026035 | Ga0207703_10000067 | Ga0207703_1000006763 | 332 |
| 122 | 3300026041 | Ga0207639_10044202 | Ga0207639_100442023 | 332 |
| 123 | 3300026078 | Ga0207702_10198121 | Ga0207702_101981212 | 332 |
| 124 | 3300026089 | Ga0207648_10000228 | Ga0207648_1000022858 | 332 |
| 125 | 3300026121 | Ga0207683_10058647 | Ga0207683_100586472 | 332 |
| 126 | 3300028379 | Ga0268266_10000023 | Ga0268266_10000023392 | 332 |
| 127 | 3300036401 | Ga0373937_0110368 | Ga0373937_0110368_1166_2173 | 332 |
| 128 | 3300044694 | Ga0466963_0000027 | Ga0466963_0000027_11226_12233 | 332 |
| 129 | 3300046454 | Ga0495592_0001977 | Ga0495592_0001977_6144_7154 | 332 |
| 130 | 3300046455 | Ga0495603_0002055 | Ga0495603_0002055_5593_6603 | 332 |
| 131 | 3300046459 | Ga0495629_0184243 | Ga0495629_0184243_180_1196 | 332 |
| 132 | 3300046461 | Ga0495641_0000001 | Ga0495641_0000001_2415_3422 | 332 |
| 133 | 3300046463 | Ga0495653_0013255 | Ga0495653_0013255_4112_5122 | 332 |
| 134 | 3300046473 | Ga0495582_0000005 | Ga0495582_0000005_138256_139269 | 332 |
| 135 | 3300046511 | Ga0495608_0031772 | Ga0495608_0031772_1476_2483 | 332 |
| 136 | 3300046515 | Ga0495620_0000580 | Ga0495620_0000580_8197_9207 | 332 |
| 137 | 3300046517 | Ga0495630_0031816 | Ga0495630_0031816_529_1539 | 332 |
| 138 | 3300046517 | Ga0495630_0085717 | Ga0495630_0085717_891_1904 | 332 |
| 139 | 3300046523 | Ga0495644_0001581 | Ga0495644_0001581_2768_3778 | 332 |
| 140 | 3300046529 | Ga0495652_0011942 | Ga0495652_0011942_1218_2234 | 332 |
| 141 | 3300046535 | Ga0495586_0008553 | Ga0495586_0008553_2802_3812 | 332 |
| 142 | 3300046536 | Ga0495587_0040018 | Ga0495587_0040018_1171_2184 | 332 |
| 143 | 3300046537 | Ga0495598_0001025 | Ga0495598_0001025_2943_3953 | 332 |
| 144 | 3300046543 | Ga0495645_0012242 | Ga0495645_0012242_1061_2077 | 332 |
| 145 | 3300046642 | Ga0495634_0001391 | Ga0495634_0001391_7653_8666 | 332 |
| 146 | 3300046642 | Ga0495634_0066151 | Ga0495634_0066151_265_1272 | 332 |
| 147 | 3300046681 | Ga0495647_0000013 | Ga0495647_0000013_80866_81876 | 332 |
| 148 | 3300046683 | Ga0495658_0000019 | Ga0495658_0000019_16912_17925 | 332 |
| 149 | 3300046684 | Ga0495669_0000163 | Ga0495669_0000163_14015_15022 | 332 |
| 150 | 3300046690 | Ga0495624_0000013 | Ga0495624_0000013_88902_89912 | 332 |
| 151 | 3300046694 | Ga0495649_0000828 | Ga0495649_0000828_8610_9620 | 332 |
| 152 | 3300047317 | Ga0495604_0000033 | Ga0495604_0000033_26290_27300 | 332 |
| 153 | 3300047321 | Ga0495676_0000091 | Ga0495676_0000091_17412_18419 | 332 |
| 154 | 3300047321 | Ga0495676_0000563 | Ga0495676_0000563_13664_14698 | 332 |
| 155 | 3300047322 | Ga0495680_0003921 | Ga0495680_0003921_5746_6753 | 332 |
| 156 | 3300047471 | Ga0495684_0185433 | Ga0495684_0185433_119_1138 | 332 |
| 157 | 3300048903 | Ga0496100_0000003 | Ga0496100_0000003_345775_346782 | 332 |
| 158 | 3300048904 | Ga0496101_0000003 | Ga0496101_0000003_345775_346782 | 332 |
| 159 | 3300048907 | Ga0496104_0000003 | Ga0496104_0000003_122099_123106 | 332 |
| 160 | 3300048908 | Ga0496105_0000031 | Ga0496105_0000031_14115_15122 | 332 |
| 161 | 3300048909 | Ga0496106_0000048 | Ga0496106_0000048_14024_15031 | 332 |
| 162 | 3300048910 | Ga0496107_0000008 | Ga0496107_0000008_236835_237842 | 332 |
| 163 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_209989_210996 | 332 |
| 164 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_209951_210958 | 332 |
| 165 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_677849_678859 | 332 |
| 166 | 3300048917 | Ga0496114_0035590 | Ga0496114_0035590_1279_2286 | 332 |
| 167 | 3300053077 | Ga0495601_0002736 | Ga0495601_0002736_8637_9644 | 332 |
| 168 | 3300053085 | Ga0495619_0000909 | Ga0495619_0000909_245_1252 | 332 |
| 169 | 3300053123 | Ga0500614_000183 | Ga0500614_000183_2387_3394 | 332 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qty-assembly1.cif.gz_A | crystal structure of phosphoribosylaminoimidazole synthetase from francisella tularensis complexed with pyrophosphate | 0.8422 | 52 | 329 |
| 3qty-assembly1.cif.gz_B | crystal structure of phosphoribosylaminoimidazole synthetase from francisella tularensis complexed with pyrophosphate | 0.8295 | 52 | 329 |
| 3kiz-assembly1.cif.gz_A | crystal structure of putative phosphoribosylformylglycinamidine cyclo-ligase (yp_676759.1) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution | 0.8214 | 58 | 325 |
| 2btu-assembly1.cif.gz_B | crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution. | 0.8154 | 53 | 327 |
| 5avm-assembly3.cif.gz_E | crystal structures of 5-aminoimidazole ribonucleotide (air) synthetase, purm, from thermus thermophilus | 0.8131 | 56 | 332 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57656_158_337_3.90.650.10 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.8845 | 164 | 322 | 3.90.650.10 |
| af_I6Y4V6_182_356_3.90.650.10 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.8779 | 170 | 326 | 3.90.650.10 |
| 5avmA02 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.8753 | 168 | 332 | 3.90.650.10 |
| af_Q2FZI8_168_339_3.90.650.10 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.8727 | 165 | 328 | 3.90.650.10 |
| 3p4eA02 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.8717 | 165 | 332 | 3.90.650.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A524JCK2-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) | 0.924 | 172 | 332 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A2U1S0H7-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) | 0.9216 | 157 | 324 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A537ZJH9-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) | 0.92 | 157 | 329 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A0G1TIW3-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) | 0.9108 | 220 | 329 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A524JCK2-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) | 0.908 | 172 | 332 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar