F254728

General Info

Members Datasets Scaffolds Average Seq Length
169 129 169 328

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10002261|Ga0157370_1000226116
Length 352
Sequence LEFPAQAHKEPERIARVSDTDAYAKAGVDQGAADSAVAGLVRALAAIELGRPSRQVPLPGHYASVIELDERTGIALSTDGVGTKLLVAEELGRFDTVGIDCVAMNVNDVICVGAEPLAMLDYIAIERADPGVCAQIGVGLARGAELAGIEIPGGELAQLGDMVRGFDIAGACFGTVALDAIVDGSAVRPGDPIVGLPSSGIHSNGYTLARSALDGLPLGEDPEARLGRPLGDVLLEPTEIYVKPVMELLRSDIEVRGLAHITSGGLGNLLRLAAPVGYEIDDPLPVPPIFELIQERAAVPDAEMRDVFNMGCGFCLVVAPDDEGAAVESMRRHYPGAKRIGRTVEGSSVRLR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
69 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
72 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
73 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
74 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
75 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
76 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
79 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
80 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
81 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
82 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
83 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
84 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
94 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
113 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
114 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
115 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
116 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 9.47
Rhizosphere 83.43
Stem 0
Stem Tuber 0
Unclassified 6.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004405 3300001979 Bacteria 6054
2 Ga0070683_100042270 3300005329 Bacteria 4197
3 Ga0070683_100068091 3300005329 Bacteria 3316
4 Ga0070677_10000048 3300005333 Bacteria 37331
5 Ga0070666_10020271 3300005335 Bacteria 4297
6 Ga0070682_100000029 3300005337 Bacteria 183516
7 Ga0068868_100129280 3300005338 Bacteria 2066
8 Ga0070674_100000033 3300005356 Bacteria 63982
9 Ga0070674_100000148 3300005356 Bacteria 32680
10 Ga0070673_100000245 3300005364 Bacteria 27379
11 Ga0070711_100002185 3300005439 Bacteria 11104
12 Ga0070663_100000641 3300005455 Bacteria 18754
13 Ga0070663_100334969 3300005455 Bacteria 1221
14 Ga0070662_100000008 3300005457 Bacteria 168754
15 Ga0070679_100000823 3300005530 Bacteria 26958
16 Ga0070679_100006876 3300005530 Bacteria 10609
17 Ga0070684_100004696 3300005535 Bacteria 10427
18 Ga0070684_100029835 3300005535 Bacteria 4626
19 Ga0068853_100060676 3300005539 Bacteria 3269
20 Ga0070665_100000120 3300005548 Bacteria 148340
21 Ga0070665_100049651 3300005548 Bacteria 4209
22 Ga0070664_100170587 3300005564 Bacteria 1930
23 Ga0068856_100026904 3300005614 Bacteria 5610
24 Ga0068864_100000044 3300005618 Bacteria 157919
25 Ga0068866_10000002 3300005718 Bacteria 394090
26 Ga0068866_10001369 3300005718 Bacteria 10515
27 Ga0068858_100000035 3300005842 Bacteria 140466
28 Ga0068858_100000042 3300005842 Bacteria 132482
29 Ga0068860_100089860 3300005843 Bacteria 2925
30 Ga0068860_100372430 3300005843 Bacteria 1409
31 Ga0070715_10000015 3300006163 Bacteria 152816
32 Ga0075433_10000031 3300006852 Bacteria 55735
33 Ga0105245_10000150 3300009098 Bacteria 66121
34 Ga0105245_10000327 3300009098 Bacteria 44888
35 Ga0105247_10000712 3300009101 Bacteria 25919
36 Ga0105242_10001663 3300009176 Bacteria 17592
37 Ga0105242_10039069 3300009176 Bacteria 3819
38 Ga0105238_10000240 3300009551 Bacteria 61138
39 Ga0105249_10000095 3300009553 Bacteria 121300
40 Ga0157370_10002261 3300013104 Bacteria 23404
41 Ga0157374_10000668 3300013296 Bacteria 30198
42 Ga0157378_10142551 3300013297 Bacteria 2226
43 Ga0163162_10586221 3300013306 Bacteria 1242
44 Ga0157375_10000723 3300013308 Bacteria 29095
45 Ga0157375_10007412 3300013308 Bacteria 9606
46 Ga0157379_10040447 3300014968 Bacteria 4161
47 Ga0157376_10306715 3300014969 Bacteria 1505
48 Ga0207682_10000168 3300025893 Bacteria 30073
49 Ga0207642_10000001 3300025899 Bacteria 714030
50 Ga0207642_10000003 3300025899 Bacteria 650651
51 Ga0207642_10000258 3300025899 Bacteria 15861
52 Ga0207680_10010856 3300025903 Bacteria 4575
53 Ga0207680_10023775 3300025903 Bacteria 3352
54 Ga0207685_10000001 3300025905 Bacteria 604473
55 Ga0207693_10098970 3300025915 Bacteria 2287
56 Ga0207663_10004223 3300025916 Bacteria 7122
57 Ga0207660_10087851 3300025917 Bacteria 2298
58 Ga0207652_10000544 3300025921 Bacteria 38182
59 Ga0207652_10010414 3300025921 Bacteria 7486
60 Ga0207646_10216877 3300025922 Bacteria 1728
61 Ga0207694_10000067 3300025924 Bacteria 128108
62 Ga0207687_10000021 3300025927 Bacteria 226396
63 Ga0207687_10000099 3300025927 Bacteria 63345
64 Ga0207706_10000016 3300025933 Bacteria 170697
65 Ga0207686_10000189 3300025934 Bacteria 47718
66 Ga0207686_10022217 3300025934 Bacteria 3652
67 Ga0207686_10032431 3300025934 Bacteria 3109
68 Ga0207669_10000014 3300025937 Bacteria 129145
69 Ga0207669_10000024 3300025937 Bacteria 96123
70 Ga0207661_10019425 3300025944 Bacteria 5066
71 Ga0207661_10028800 3300025944 Bacteria 4258
72 Ga0207651_10002099 3300025960 Bacteria 9408
73 Ga0207712_10000003 3300025961 Bacteria 615314
74 Ga0207640_10007639 3300025981 Bacteria 5971
75 Ga0207658_10004671 3300025986 Bacteria 9492
76 Ga0207677_10000376 3300026023 Bacteria 30827
77 Ga0207703_10000060 3300026035 Bacteria 134334
78 Ga0207703_10000067 3300026035 Bacteria 125623
79 Ga0207639_10044202 3300026041 Bacteria 3349
80 Ga0207678_10001410 3300026067 Bacteria 22098
81 Ga0207702_10198121 3300026078 Bacteria 1860
82 Ga0207648_10000228 3300026089 Bacteria 60032
83 Ga0207676_10000043 3300026095 Bacteria 161948
84 Ga0207683_10058647 3300026121 Bacteria 3380
85 Ga0268266_10000023 3300028379 Bacteria 501899
86 Ga0268266_10004808 3300028379 Bacteria 12826
87 Ga0268266_10050383 3300028379 Bacteria 3573
88 Ga0373937_0110368 3300036401 Bacteria 2558
89 Ga0395905_0050836 3300037471 Bacteria 3883
90 Ga0395901_0093006 3300038443 Bacteria 3157
91 Ga0466963_0000027 3300044694 Bacteria 48596
92 Ga0495592_0001977 3300046454 Bacteria 14474
93 Ga0495603_0002055 3300046455 Bacteria 11838
94 Ga0495629_0184243 3300046459 Bacteria 1446
95 Ga0495641_0000001 3300046461 Bacteria 485224
96 Ga0495653_0013255 3300046463 Bacteria 6721
97 Ga0495582_0000005 3300046473 Bacteria 156170
98 Ga0495608_0031772 3300046511 Bacteria 3568
99 Ga0495620_0000580 3300046515 Bacteria 22923
100 Ga0495628_0096102 3300046516 Bacteria 2289
101 Ga0495630_0031816 3300046517 Bacteria 3929
102 Ga0495630_0085717 3300046517 Bacteria 2378
103 Ga0495644_0001581 3300046523 Bacteria 9286
104 Ga0495652_0011942 3300046529 Bacteria 7854
105 Ga0495586_0008553 3300046535 Bacteria 5449
106 Ga0495587_0040018 3300046536 Bacteria 2803
107 Ga0495598_0001025 3300046537 Bacteria 5349
108 Ga0495645_0012242 3300046543 Bacteria 6042
109 Ga0495633_0152163 3300046558 Bacteria 1068
110 Ga0495667_0019713 3300046559 Bacteria 4551
111 Ga0495656_0010420 3300046615 Bacteria 3380
112 Ga0495634_0001391 3300046642 Bacteria 21767
113 Ga0495634_0066151 3300046642 Bacteria 2393
114 Ga0495635_0034130 3300046663 Bacteria 3530
115 Ga0495647_0000013 3300046681 Bacteria 88029
116 Ga0495658_0000019 3300046683 Bacteria 91606
117 Ga0495669_0000163 3300046684 Bacteria 42549
118 Ga0495613_0036061 3300046689 Bacteria 3667
119 Ga0495624_0000013 3300046690 Bacteria 115278
120 Ga0495649_0000828 3300046694 Bacteria 24830
121 Ga0495604_0000033 3300047317 Bacteria 134810
122 Ga0495676_0000091 3300047321 Bacteria 66575
123 Ga0495676_0000563 3300047321 Bacteria 30429
124 Ga0495680_0003921 3300047322 Bacteria 14394
125 Ga0495684_0185433 3300047471 Bacteria 1541
126 Ga0496100_0000003 3300048903 Bacteria 360802
127 Ga0496100_0209268 3300048903 Bacteria 1426
128 Ga0496101_0000003 3300048904 Bacteria 406565
129 Ga0496102_0001497 3300048905 Bacteria 20646
130 Ga0496102_0102944 3300048905 Bacteria 2655
131 Ga0496103_0113362 3300048906 Bacteria 1723
132 Ga0496104_0000003 3300048907 Bacteria 669219
133 Ga0496105_0000031 3300048908 Bacteria 137220
134 Ga0496106_0000048 3300048909 Bacteria 98233
135 Ga0496107_0000008 3300048910 Bacteria 251874
136 Ga0496108_0000002 3300048911 Bacteria 700890
137 Ga0496109_0000001 3300048912 Bacteria 700852
138 Ga0496109_0000237 3300048912 Bacteria 53743
139 Ga0496110_0008421 3300048913 Bacteria 8299
140 Ga0496112_0000002 3300048915 Bacteria 782039
141 Ga0496114_0035590 3300048917 Bacteria 4112
142 Ga0496116_0000014 3300048919 Bacteria 569049
143 Ga0496117_0002396 3300048920 Bacteria 23836
144 Ga0496118_0001663 3300048921 Bacteria 32640
145 Ga0496118_0094958 3300048921 Bacteria 2037
146 Ga0496118_0169502 3300048921 Bacteria 1336
147 Ga0496119_0000441 3300048922 Bacteria 56986
148 Ga0496120_0007177 3300048923 Bacteria 8350
149 Ga0496121_0006409 3300048924 Bacteria 14630
150 Ga0496121_0036079 3300048924 Bacteria 4413
151 Ga0496126_0041602 3300048929 Bacteria 4250
152 Ga0496126_0047669 3300048929 Bacteria 3922
153 Ga0501047_0046671 3300049581 Bacteria 4186
154 Ga0501047_0242994 3300049581 Bacteria 1650
155 Ga0501069_0033304 3300049585 Bacteria 2838
156 Ga0501071_0052088 3300049587 Bacteria 2951
157 Ga0501079_0015984 3300049741 Bacteria 5735
158 Ga0501080_0019251 3300049742 Bacteria 6322
159 Ga0501083_0032402 3300049744 Bacteria 3583
160 Ga0501083_0050230 3300049744 Bacteria 2807
161 Ga0501083_0106744 3300049744 Bacteria 1843
162 Ga0501044_0035752 3300049823 Bacteria 5200
163 nmdc:mga0a205_9_c1 3300050515 Bacteria 55726
164 Ga0495601_0002736 3300053077 Bacteria 10019
165 Ga0495619_0000129 3300053085 Bacteria 55936
166 Ga0495619_0000192 3300053085 Bacteria 45153
167 Ga0495619_0000909 3300053085 Bacteria 19385
168 Ga0495619_0011588 3300053085 Bacteria 5555
169 Ga0500614_000183 3300053123 Bacteria 16149

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046689 Ga0495613_0036061 Ga0495613_0036061_39_905 285
2 3300048929 Ga0496126_0047669 Ga0496126_0047669_2207_3184 295
3 3300049581 Ga0501047_0242994 Ga0501047_0242994_489_1493 298
4 3300028379 Ga0268266_10050383 Ga0268266_100503833 302
5 3300048919 Ga0496116_0000014 Ga0496116_0000014_461001_462005 302
6 3300048921 Ga0496118_0094958 Ga0496118_0094958_268_1272 302
7 3300048921 Ga0496118_0169502 Ga0496118_0169502_222_1232 302
8 3300048922 Ga0496119_0000441 Ga0496119_0000441_839_1843 302
9 3300048924 Ga0496121_0006409 Ga0496121_0006409_6113_7120 302
10 3300049581 Ga0501047_0046671 Ga0501047_0046671_2459_3463 302
11 3300049585 Ga0501069_0033304 Ga0501069_0033304_140_1144 302
12 3300049587 Ga0501071_0052088 Ga0501071_0052088_316_1320 302
13 3300049741 Ga0501079_0015984 Ga0501079_0015984_4062_5066 302
14 3300049742 Ga0501080_0019251 Ga0501080_0019251_4498_5502 302
15 3300049744 Ga0501083_0050230 Ga0501083_0050230_1699_2703 302
16 3300049823 Ga0501044_0035752 Ga0501044_0035752_4041_5045 302
17 3300005335 Ga0070666_10020271 Ga0070666_100202712 303
18 3300005843 Ga0068860_100372430 Ga0068860_1003724302 303
19 3300013306 Ga0163162_10586221 Ga0163162_105862211 303
20 3300014969 Ga0157376_10306715 Ga0157376_103067152 303
21 3300025903 Ga0207680_10023775 Ga0207680_100237753 303
22 3300048903 Ga0496100_0209268 Ga0496100_0209268_32_1042 303
23 3300048905 Ga0496102_0001497 Ga0496102_0001497_12559_13566 303
24 3300048906 Ga0496103_0113362 Ga0496103_0113362_466_1473 303
25 3300048920 Ga0496117_0002396 Ga0496117_0002396_18636_19643 303
26 3300048921 Ga0496118_0001663 Ga0496118_0001663_13462_14469 303
27 3300048923 Ga0496120_0007177 Ga0496120_0007177_3616_4623 303
28 3300048924 Ga0496121_0036079 Ga0496121_0036079_1275_2279 303
29 3300048929 Ga0496126_0041602 Ga0496126_0041602_585_1589 303
30 3300049744 Ga0501083_0032402 Ga0501083_0032402_1872_2882 303
31 3300049744 Ga0501083_0106744 Ga0501083_0106744_377_1381 303
32 3300025915 Ga0207693_10098970 Ga0207693_100989703 304
33 3300048905 Ga0496102_0102944 Ga0496102_0102944_829_1839 304
34 3300005457 Ga0070662_100000008 Ga0070662_100000008117 305
35 3300025933 Ga0207706_10000016 Ga0207706_1000001657 305
36 3300005548 Ga0070665_100049651 Ga0070665_1000496514 306
37 3300025903 Ga0207680_10010856 Ga0207680_100108562 306
38 3300025986 Ga0207658_10004671 Ga0207658_100046712 306
39 3300028379 Ga0268266_10004808 Ga0268266_100048086 306
40 3300053085 Ga0495619_0011588 Ga0495619_0011588_3873_4883 306
41 3300013308 Ga0157375_10007412 Ga0157375_100074122 310
42 3300046558 Ga0495633_0152163 Ga0495633_0152163_94_1038 311
43 3300006852 Ga0075433_10000031 Ga0075433_1000003116 314
44 3300050515 nmdc:mga0a205_9_c1 nmdc:mga0a205_9_c1_14034_15053 314
45 3300005329 Ga0070683_100068091 Ga0070683_1000680911 317
46 3300005455 Ga0070663_100000641 Ga0070663_10000064117 317
47 3300005530 Ga0070679_100006876 Ga0070679_1000068763 317
48 3300025921 Ga0207652_10010414 Ga0207652_100104141 317
49 3300025944 Ga0207661_10019425 Ga0207661_100194255 317
50 3300026067 Ga0207678_10001410 Ga0207678_1000141021 317
51 3300037471 Ga0395905_0050836 Ga0395905_0050836_1033_2034 321
52 3300038443 Ga0395901_0093006 Ga0395901_0093006_1934_2935 321
53 3300046663 Ga0495635_0034130 Ga0495635_0034130_664_1665 330
54 3300005356 Ga0070674_100000148 Ga0070674_1000001485 331
55 3300005455 Ga0070663_100334969 Ga0070663_1003349691 331
56 3300005618 Ga0068864_100000044 Ga0068864_100000044105 331
57 3300005718 Ga0068866_10001369 Ga0068866_100013695 331
58 3300005842 Ga0068858_100000042 Ga0068858_100000042107 331
59 3300009176 Ga0105242_10039069 Ga0105242_100390694 331
60 3300013104 Ga0157370_10002261 Ga0157370_1000226116 331
61 3300025899 Ga0207642_10000258 Ga0207642_100002582 331
62 3300025922 Ga0207646_10216877 Ga0207646_102168772 331
63 3300025934 Ga0207686_10022217 Ga0207686_100222172 331
64 3300025934 Ga0207686_10032431 Ga0207686_100324312 331
65 3300025937 Ga0207669_10000014 Ga0207669_1000001497 331
66 3300026035 Ga0207703_10000060 Ga0207703_1000006029 331
67 3300026095 Ga0207676_10000043 Ga0207676_10000043104 331
68 3300046516 Ga0495628_0096102 Ga0495628_0096102_170_1180 331
69 3300046559 Ga0495667_0019713 Ga0495667_0019713_3181_4191 331
70 3300046615 Ga0495656_0010420 Ga0495656_0010420_855_1865 331
71 3300048912 Ga0496109_0000237 Ga0496109_0000237_39774_40784 331
72 3300048913 Ga0496110_0008421 Ga0496110_0008421_5554_6561 331
73 3300053085 Ga0495619_0000129 Ga0495619_0000129_44374_45384 331
74 3300053085 Ga0495619_0000192 Ga0495619_0000192_21788_22804 331
75 3300001979 JGI24740J21852_10004405 JGI24740J21852_100044055 332
76 3300005329 Ga0070683_100042270 Ga0070683_1000422703 332
77 3300005333 Ga0070677_10000048 Ga0070677_100000485 332
78 3300005337 Ga0070682_100000029 Ga0070682_100000029138 332
79 3300005338 Ga0068868_100129280 Ga0068868_1001292802 332
80 3300005356 Ga0070674_100000033 Ga0070674_10000003342 332
81 3300005364 Ga0070673_100000245 Ga0070673_10000024512 332
82 3300005439 Ga0070711_100002185 Ga0070711_1000021854 332
83 3300005530 Ga0070679_100000823 Ga0070679_1000008236 332
84 3300005535 Ga0070684_100004696 Ga0070684_1000046967 332
85 3300005535 Ga0070684_100029835 Ga0070684_1000298354 332
86 3300005539 Ga0068853_100060676 Ga0068853_1000606762 332
87 3300005548 Ga0070665_100000120 Ga0070665_10000012032 332
88 3300005564 Ga0070664_100170587 Ga0070664_1001705871 332
89 3300005614 Ga0068856_100026904 Ga0068856_1000269042 332
90 3300005718 Ga0068866_10000002 Ga0068866_1000000296 332
91 3300005842 Ga0068858_100000035 Ga0068858_10000003530 332
92 3300005843 Ga0068860_100089860 Ga0068860_1000898602 332
93 3300006163 Ga0070715_10000015 Ga0070715_1000001573 332
94 3300009098 Ga0105245_10000150 Ga0105245_1000015015 332
95 3300009098 Ga0105245_10000327 Ga0105245_1000032726 332
96 3300009101 Ga0105247_10000712 Ga0105247_100007128 332
97 3300009176 Ga0105242_10001663 Ga0105242_1000166315 332
98 3300009551 Ga0105238_10000240 Ga0105238_1000024026 332
99 3300009553 Ga0105249_10000095 Ga0105249_1000009522 332
100 3300013296 Ga0157374_10000668 Ga0157374_1000066823 332
101 3300013297 Ga0157378_10142551 Ga0157378_101425512 332
102 3300013308 Ga0157375_10000723 Ga0157375_100007231 332
103 3300014968 Ga0157379_10040447 Ga0157379_100404474 332
104 3300025893 Ga0207682_10000168 Ga0207682_1000016828 332
105 3300025899 Ga0207642_10000001 Ga0207642_10000001512 332
106 3300025899 Ga0207642_10000003 Ga0207642_10000003512 332
107 3300025905 Ga0207685_10000001 Ga0207685_10000001353 332
108 3300025916 Ga0207663_10004223 Ga0207663_100042234 332
109 3300025917 Ga0207660_10087851 Ga0207660_100878512 332
110 3300025921 Ga0207652_10000544 Ga0207652_100005446 332
111 3300025924 Ga0207694_10000067 Ga0207694_1000006790 332
112 3300025927 Ga0207687_10000021 Ga0207687_1000002126 332
113 3300025927 Ga0207687_10000099 Ga0207687_1000009914 332
114 3300025934 Ga0207686_10000189 Ga0207686_100001893 332
115 3300025937 Ga0207669_10000024 Ga0207669_1000002492 332
116 3300025944 Ga0207661_10028800 Ga0207661_100288002 332
117 3300025960 Ga0207651_10002099 Ga0207651_100020992 332
118 3300025961 Ga0207712_10000003 Ga0207712_10000003516 332
119 3300025981 Ga0207640_10007639 Ga0207640_100076393 332
120 3300026023 Ga0207677_10000376 Ga0207677_1000037626 332
121 3300026035 Ga0207703_10000067 Ga0207703_1000006763 332
122 3300026041 Ga0207639_10044202 Ga0207639_100442023 332
123 3300026078 Ga0207702_10198121 Ga0207702_101981212 332
124 3300026089 Ga0207648_10000228 Ga0207648_1000022858 332
125 3300026121 Ga0207683_10058647 Ga0207683_100586472 332
126 3300028379 Ga0268266_10000023 Ga0268266_10000023392 332
127 3300036401 Ga0373937_0110368 Ga0373937_0110368_1166_2173 332
128 3300044694 Ga0466963_0000027 Ga0466963_0000027_11226_12233 332
129 3300046454 Ga0495592_0001977 Ga0495592_0001977_6144_7154 332
130 3300046455 Ga0495603_0002055 Ga0495603_0002055_5593_6603 332
131 3300046459 Ga0495629_0184243 Ga0495629_0184243_180_1196 332
132 3300046461 Ga0495641_0000001 Ga0495641_0000001_2415_3422 332
133 3300046463 Ga0495653_0013255 Ga0495653_0013255_4112_5122 332
134 3300046473 Ga0495582_0000005 Ga0495582_0000005_138256_139269 332
135 3300046511 Ga0495608_0031772 Ga0495608_0031772_1476_2483 332
136 3300046515 Ga0495620_0000580 Ga0495620_0000580_8197_9207 332
137 3300046517 Ga0495630_0031816 Ga0495630_0031816_529_1539 332
138 3300046517 Ga0495630_0085717 Ga0495630_0085717_891_1904 332
139 3300046523 Ga0495644_0001581 Ga0495644_0001581_2768_3778 332
140 3300046529 Ga0495652_0011942 Ga0495652_0011942_1218_2234 332
141 3300046535 Ga0495586_0008553 Ga0495586_0008553_2802_3812 332
142 3300046536 Ga0495587_0040018 Ga0495587_0040018_1171_2184 332
143 3300046537 Ga0495598_0001025 Ga0495598_0001025_2943_3953 332
144 3300046543 Ga0495645_0012242 Ga0495645_0012242_1061_2077 332
145 3300046642 Ga0495634_0001391 Ga0495634_0001391_7653_8666 332
146 3300046642 Ga0495634_0066151 Ga0495634_0066151_265_1272 332
147 3300046681 Ga0495647_0000013 Ga0495647_0000013_80866_81876 332
148 3300046683 Ga0495658_0000019 Ga0495658_0000019_16912_17925 332
149 3300046684 Ga0495669_0000163 Ga0495669_0000163_14015_15022 332
150 3300046690 Ga0495624_0000013 Ga0495624_0000013_88902_89912 332
151 3300046694 Ga0495649_0000828 Ga0495649_0000828_8610_9620 332
152 3300047317 Ga0495604_0000033 Ga0495604_0000033_26290_27300 332
153 3300047321 Ga0495676_0000091 Ga0495676_0000091_17412_18419 332
154 3300047321 Ga0495676_0000563 Ga0495676_0000563_13664_14698 332
155 3300047322 Ga0495680_0003921 Ga0495680_0003921_5746_6753 332
156 3300047471 Ga0495684_0185433 Ga0495684_0185433_119_1138 332
157 3300048903 Ga0496100_0000003 Ga0496100_0000003_345775_346782 332
158 3300048904 Ga0496101_0000003 Ga0496101_0000003_345775_346782 332
159 3300048907 Ga0496104_0000003 Ga0496104_0000003_122099_123106 332
160 3300048908 Ga0496105_0000031 Ga0496105_0000031_14115_15122 332
161 3300048909 Ga0496106_0000048 Ga0496106_0000048_14024_15031 332
162 3300048910 Ga0496107_0000008 Ga0496107_0000008_236835_237842 332
163 3300048911 Ga0496108_0000002 Ga0496108_0000002_209989_210996 332
164 3300048912 Ga0496109_0000001 Ga0496109_0000001_209951_210958 332
165 3300048915 Ga0496112_0000002 Ga0496112_0000002_677849_678859 332
166 3300048917 Ga0496114_0035590 Ga0496114_0035590_1279_2286 332
167 3300053077 Ga0495601_0002736 Ga0495601_0002736_8637_9644 332
168 3300053085 Ga0495619_0000909 Ga0495619_0000909_245_1252 332
169 3300053123 Ga0500614_000183 Ga0500614_000183_2387_3394 332

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

60

176

0.95

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

188

352

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qty-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazole synthetase from francisella tularensis complexed with pyrophosphate 0.8422 52 329
3qty-assembly1.cif.gz_B crystal structure of phosphoribosylaminoimidazole synthetase from francisella tularensis complexed with pyrophosphate 0.8295 52 329
3kiz-assembly1.cif.gz_A crystal structure of putative phosphoribosylformylglycinamidine cyclo-ligase (yp_676759.1) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution 0.8214 58 325
2btu-assembly1.cif.gz_B crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution. 0.8154 53 327
5avm-assembly3.cif.gz_E crystal structures of 5-aminoimidazole ribonucleotide (air) synthetase, purm, from thermus thermophilus 0.8131 56 332
ID Description Score Start End Superfamily
af_Q57656_158_337_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.8845 164 322 3.90.650.10
af_I6Y4V6_182_356_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.8779 170 326 3.90.650.10
5avmA02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.8753 168 332 3.90.650.10
af_Q2FZI8_168_339_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.8727 165 328 3.90.650.10
3p4eA02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.8717 165 332 3.90.650.10
ID Description Score Start End GO Terms
AF-A0A524JCK2-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.924 172 332 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A2U1S0H7-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.9216 157 324 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A537ZJH9-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.92 157 329 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A0G1TIW3-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.9108 220 329 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A524JCK2-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.908 172 332 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084

Feature Viewer

pLDDT pTM Quality
64.73 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map