F252366

General Info

Members Datasets Scaffolds Average Seq Length
168 130 336 107

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10213518|Ga0075365_102135182
Length 107
Sequence MMVLVTTDVFGAIANPTRRQLLVLLRGGPMNVTAMAEQFALGRPAISEHLKVLRDAGLVREEPRGRERFYHLDAEPLREVGEWLGPYEQFWRAKLAGLRDLLDEEHA

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
78 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
85 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
86 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
87 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
101 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
122 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
123 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
124 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
125 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
126 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
127 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 0
Rhizoplane 10.71
Rhizosphere 77.98
Stem 0
Stem Tuber 0
Unclassified 25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10213518 3300006038 Bacteria 1353
2 rootH2_10003044 3300003320 Bacteria 2205
3 rootH2_10062415 3300003320 Bacteria 5595
4 rootH2_10218514 3300003320 Bacteria 3020
5 rootH2_10294862 3300003320 Bacteria 2756
6 rootH1_10016243 3300003323 Bacteria 5504
7 rootH1_10016800 3300003323 Bacteria 32259
8 JGI25404J52841_10046827 3300003659 Unclassified 911
9 JGI25405J52794_10020511 3300003911 Unclassified 1331
10 Ga0065704_10074188 3300005289 Bacteria 6462
11 Ga0070683_101194485 3300005329 Unclassified 731
12 Ga0070680_100010356 3300005336 Bacteria 7188
13 Ga0070682_100706095 3300005337 Bacteria 809
14 Ga0068868_101241193 3300005338 Bacteria 690
15 Ga0070660_100355648 3300005339 Bacteria 1207
16 Ga0070689_100138411 3300005340 Bacteria 1956
17 Ga0070691_10476405 3300005341 Bacteria 717
18 Ga0070661_100631165 3300005344 Bacteria 868
19 Ga0070688_101238859 3300005365 Bacteria 600
20 Ga0070713_100522960 3300005436 Bacteria 1121
21 Ga0070713_100583436 3300005436 Bacteria 1061
22 Ga0070710_10825599 3300005437 Bacteria 664
23 Ga0070711_101435978 3300005439 Unclassified 601
24 Ga0070700_100185337 3300005441 Unclassified 1451
25 Ga0070681_10532450 3300005458 Bacteria 1088
26 Ga0070679_100015674 3300005530 Bacteria 7287
27 Ga0070679_100867331 3300005530 Bacteria 846
28 Ga0070684_100957076 3300005535 Bacteria 803
29 Ga0070684_101455577 3300005535 Bacteria 645
30 Ga0070684_101856322 3300005535 Bacteria 569
31 Ga0068855_100000914 3300005563 Bacteria 36662
32 Ga0068855_100030539 3300005563 Bacteria 6444
33 Ga0068854_101247534 3300005578 Bacteria 667
34 Ga0068856_100229224 3300005614 Bacteria 1873
35 Ga0068852_102522770 3300005616 Bacteria 534
36 Ga0068852_102609364 3300005616 Unclassified 525
37 Ga0068859_100126776 3300005617 Bacteria 2622
38 Ga0068861_100071401 3300005719 Unclassified 2691
39 Ga0068863_100541055 3300005841 Unclassified 1149
40 Ga0068862_102490382 3300005844 Unclassified 529
41 Ga0081455_10000324 3300005937 Bacteria 62520
42 Ga0081540_1002294 3300005983 Bacteria 15717
43 Ga0070717_10727594 3300006028 Bacteria 902
44 Ga0075429_101129870 3300006880 Bacteria 684
45 Ga0097620_100126778 3300006931 Bacteria 2622
46 Ga0099795_10523263 3300007788 Unclassified 556
47 Ga0105240_10001126 3300009093 Bacteria 46950
48 Ga0105240_11566874 3300009093 Bacteria 690
49 Ga0111539_10277073 3300009094 Unclassified 1952
50 Ga0105237_10001567 3300009545 Bacteria 29808
51 Ga0105238_10008699 3300009551 Bacteria 10155
52 Ga0105238_11020393 3300009551 Bacteria 848
53 Ga0105249_11403850 3300009553 Bacteria 770
54 Ga0099796_10035042 3300010159 Bacteria 1662
55 Ga0105239_10246724 3300010375 Bacteria 2005
56 Ga0105246_11525693 3300011119 Bacteria 628
57 Ga0157374_10082604 3300013296 Bacteria 3051
58 Ga0157379_10524996 3300014968 Unclassified 1099
59 Ga0157376_11421787 3300014969 Bacteria 725
60 Ga0213875_10036172 3300021388 Bacteria 2328
61 Ga0207705_10020613 3300025909 Bacteria 4707
62 Ga0207707_10309761 3300025912 Bacteria 1364
63 Ga0207695_10001239 3300025913 Bacteria 43698
64 Ga0207671_10000930 3300025914 Bacteria 36675
65 Ga0207663_11402274 3300025916 Unclassified 563
66 Ga0207660_10105306 3300025917 Bacteria 2114
67 Ga0207660_11141885 3300025917 Bacteria 634
68 Ga0207657_10318153 3300025919 Bacteria 1231
69 Ga0207652_10002284 3300025921 Bacteria 16265
70 Ga0207652_10046415 3300025921 Bacteria 3706
71 Ga0207652_10431609 3300025921 Bacteria 1188
72 Ga0207694_10003354 3300025924 Bacteria 12745
73 Ga0207700_10305982 3300025928 Bacteria 1374
74 Ga0207700_10992919 3300025928 Bacteria 751
75 Ga0207670_10839057 3300025936 Bacteria 767
76 Ga0207661_11103135 3300025944 Unclassified 731
77 Ga0207667_10013175 3300025949 Bacteria 9479
78 Ga0207667_10022794 3300025949 Bacteria 6907
79 Ga0207677_11071250 3300026023 Bacteria 734
80 Ga0207677_12281786 3300026023 Bacteria 504
81 Ga0207708_10234198 3300026075 Unclassified 1475
82 Ga0207708_11230460 3300026075 Bacteria 655
83 Ga0207702_11130939 3300026078 Unclassified 777
84 Ga0207674_10081830 3300026116 Bacteria 3231
85 Ga0207675_100127968 3300026118 Bacteria 2407
86 Ga0207698_11190600 3300026142 Bacteria 776
87 Ga0207698_11497233 3300026142 Unclassified 690
88 Ga0209179_1059239 3300027512 Unclassified 829
89 Ga0207428_10184180 3300027907 Unclassified 1576
90 Ga0265338_10056119 3300028800 Bacteria 3497
91 Ga0265324_10000081 3300029957 Bacteria 75195
92 Ga0265325_10219770 3300031241 Unclassified 870
93 Ga0307408_100554748 3300031548 Bacteria 1014
94 Ga0265314_10397844 3300031711 Unclassified 746
95 Ga0373943_0725035 3300035170 Bacteria 590
96 Ga0373935_0900237 3300035692 Unclassified 655
97 Ga0373927_0084724 3300035695 Bacteria 2056
98 Ga0373933_0003678 3300035724 Bacteria 8490
99 Ga0373937_0540399 3300036401 Unclassified 1107
100 Ga0373937_2088962 3300036401 Unclassified 512
101 Ga0395900_0470711 3300037418 Unclassified 1210
102 Ga0395905_0139627 3300037471 Bacteria 2280
103 Ga0395905_0235295 3300037471 Unclassified 1712
104 Ga0395905_0255223 3300037471 Bacteria 1638
105 Ga0436364_0132646 3300037853 Bacteria 6280
106 Ga0436361_1027758 3300039447 Bacteria 725
107 Ga0451791_0967605 3300041451 Bacteria 542
108 Ga0451791_1497648 3300041451 Bacteria 577
109 Ga0451800_1269933 3300041459 Unclassified 1375
110 Ga0451800_1587847 3300041459 Bacteria 726
111 Ga0451802_1784369 3300041460 Bacteria 1281
112 Ga0451843_0457426 3300041509 Unclassified 570
113 Ga0451853_2401995 3300041512 Bacteria 682
114 Ga0451577_1175146 3300042876 Bacteria 685
115 Ga0466972_0048484 3300044658 Bacteria 2052
116 Ga0466961_0045551 3300044693 Bacteria 2807
117 Ga0466961_0099336 3300044693 Bacteria 1834
118 Ga0466970_0006506 3300044765 Bacteria 5838
119 Ga0466960_0880012 3300044901 Unclassified 545
120 Ga0451576_0032574 3300045051 Bacteria 5547
121 Ga0466967_2295670 3300045976 Unclassified 535
122 Ga0466967_2519268 3300045976 Unclassified 509
123 Ga0466967_2523969 3300045976 Bacteria 509
124 Ga0495603_0876714 3300046455 Bacteria 510
125 Ga0495651_0268343 3300046462 Bacteria 1158
126 Ga0495608_0221918 3300046511 Bacteria 1186
127 Ga0495630_0636800 3300046517 Bacteria 817
128 Ga0495656_0726149 3300046615 Bacteria 535
129 Ga0495657_0228532 3300046675 Bacteria 1126
130 Ga0495657_0351572 3300046675 Bacteria 872
131 Ga0495613_0751817 3300046689 Bacteria 639
132 Ga0495600_0050900 3300046809 Bacteria 2703
133 Ga0496101_0177790 3300048904 Bacteria 1638
134 Ga0496104_0082962 3300048907 Bacteria 3057
135 Ga0496104_1071005 3300048907 Bacteria 710
136 Ga0496105_0109792 3300048908 Unclassified 2277
137 Ga0496105_0294111 3300048908 Unclassified 1307
138 Ga0496105_0304739 3300048908 Unclassified 1280
139 Ga0496106_0459920 3300048909 Bacteria 1022
140 Ga0496110_1684530 3300048913 Bacteria 544
141 Ga0496114_0006275 3300048917 Bacteria 9359
142 Ga0496114_0013381 3300048917 Bacteria 6578
143 Ga0496114_0701809 3300048917 Unclassified 887
144 Ga0496115_0285402 3300048918 Bacteria 1355
145 Ga0496115_0329236 3300048918 Unclassified 1248
146 Ga0496121_0390444 3300048924 Bacteria 915
147 Ga0496126_1395209 3300048929 Unclassified 506
148 Ga0501034_0011465 3300049571 Bacteria 9185
149 Ga0501034_0156385 3300049571 Bacteria 2253
150 Ga0501034_0965845 3300049571 Bacteria 737
151 Ga0501047_0099493 3300049581 Bacteria 2787
152 Ga0501069_0456619 3300049585 Bacteria 760
153 Ga0501261_065046 3300049690 Bacteria 628
154 Ga0501083_0024907 3300049744 Bacteria 4144
155 Ga0501083_0060856 3300049744 Bacteria 2522
156 nmdc:mga0yw44_343493_c1 3300050492 Bacteria 1004
157 nmdc:mga08y16_52985_c1 3300050511 Bacteria 4243
158 Ga0495601_1040377 3300053077 Unclassified 514
159 Ga0495595_0682533 3300053084 Unclassified 526
160 Ga0495619_0879619 3300053085 Unclassified 603
161 Ga0500591_090395 3300053115 Bacteria 1338
162 Ga0500658_0352778 3300053134 Unclassified 675
163 Ga0500568_0005839 3300053139 Bacteria 6275
164 Ga0500616_0000913 3300053153 Bacteria 32305
165 Ga0500624_138908 3300053157 Unclassified 518
166 Ga0501084_0002658 3300054114 Bacteria 14402
167 Ga0501082_0020439 3300060353 Bacteria 5709
168 8001784667 8001781756 Bacteria 9586736
169 Ga0075365_10213518
170 rootH2_10003044
171 rootH2_10062415
172 rootH2_10218514
173 rootH2_10294862
174 rootH1_10016243
175 rootH1_10016800
176 JGI25404J52841_10046827
177 JGI25405J52794_10020511
178 Ga0065704_10074188
179 Ga0070683_101194485
180 Ga0070680_100010356
181 Ga0070682_100706095
182 Ga0068868_101241193
183 Ga0070660_100355648
184 Ga0070689_100138411
185 Ga0070691_10476405
186 Ga0070661_100631165
187 Ga0070688_101238859
188 Ga0070713_100522960
189 Ga0070713_100583436
190 Ga0070710_10825599
191 Ga0070711_101435978
192 Ga0070700_100185337
193 Ga0070681_10532450
194 Ga0070679_100015674
195 Ga0070679_100867331
196 Ga0070684_100957076
197 Ga0070684_101455577
198 Ga0070684_101856322
199 Ga0068855_100000914
200 Ga0068855_100030539
201 Ga0068854_101247534
202 Ga0068856_100229224
203 Ga0068852_102522770
204 Ga0068852_102609364
205 Ga0068859_100126776
206 Ga0068861_100071401
207 Ga0068863_100541055
208 Ga0068862_102490382
209 Ga0081455_10000324
210 Ga0081540_1002294
211 Ga0070717_10727594
212 Ga0075429_101129870
213 Ga0097620_100126778
214 Ga0099795_10523263
215 Ga0105240_10001126
216 Ga0105240_11566874
217 Ga0111539_10277073
218 Ga0105237_10001567
219 Ga0105238_10008699
220 Ga0105238_11020393
221 Ga0105249_11403850
222 Ga0099796_10035042
223 Ga0105239_10246724
224 Ga0105246_11525693
225 Ga0157374_10082604
226 Ga0157379_10524996
227 Ga0157376_11421787
228 Ga0213875_10036172
229 Ga0207705_10020613
230 Ga0207707_10309761
231 Ga0207695_10001239
232 Ga0207671_10000930
233 Ga0207663_11402274
234 Ga0207660_10105306
235 Ga0207660_11141885
236 Ga0207657_10318153
237 Ga0207652_10002284
238 Ga0207652_10046415
239 Ga0207652_10431609
240 Ga0207694_10003354
241 Ga0207700_10305982
242 Ga0207700_10992919
243 Ga0207670_10839057
244 Ga0207661_11103135
245 Ga0207667_10013175
246 Ga0207667_10022794
247 Ga0207677_11071250
248 Ga0207677_12281786
249 Ga0207708_10234198
250 Ga0207708_11230460
251 Ga0207702_11130939
252 Ga0207674_10081830
253 Ga0207675_100127968
254 Ga0207698_11190600
255 Ga0207698_11497233
256 Ga0209179_1059239
257 Ga0207428_10184180
258 Ga0265338_10056119
259 Ga0265324_10000081
260 Ga0265325_10219770
261 Ga0307408_100554748
262 Ga0265314_10397844
263 Ga0373943_0725035
264 Ga0373935_0900237
265 Ga0373927_0084724
266 Ga0373933_0003678
267 Ga0373937_0540399
268 Ga0373937_2088962
269 Ga0395900_0470711
270 Ga0395905_0139627
271 Ga0395905_0235295
272 Ga0395905_0255223
273 Ga0436364_0132646
274 Ga0436361_1027758
275 Ga0451791_0967605
276 Ga0451791_1497648
277 Ga0451800_1269933
278 Ga0451800_1587847
279 Ga0451802_1784369
280 Ga0451843_0457426
281 Ga0451853_2401995
282 Ga0451577_1175146
283 Ga0466972_0048484
284 Ga0466961_0045551
285 Ga0466961_0099336
286 Ga0466970_0006506
287 Ga0466960_0880012
288 Ga0451576_0032574
289 Ga0466967_2295670
290 Ga0466967_2519268
291 Ga0466967_2523969
292 Ga0495603_0876714
293 Ga0495651_0268343
294 Ga0495608_0221918
295 Ga0495630_0636800
296 Ga0495656_0726149
297 Ga0495657_0228532
298 Ga0495657_0351572
299 Ga0495613_0751817
300 Ga0495600_0050900
301 Ga0496101_0177790
302 Ga0496104_0082962
303 Ga0496104_1071005
304 Ga0496105_0109792
305 Ga0496105_0294111
306 Ga0496105_0304739
307 Ga0496106_0459920
308 Ga0496110_1684530
309 Ga0496114_0006275
310 Ga0496114_0013381
311 Ga0496114_0701809
312 Ga0496115_0285402
313 Ga0496115_0329236
314 Ga0496121_0390444
315 Ga0496126_1395209
316 Ga0501034_0011465
317 Ga0501034_0156385
318 Ga0501034_0965845
319 Ga0501047_0099493
320 Ga0501069_0456619
321 Ga0501261_065046
322 Ga0501083_0024907
323 Ga0501083_0060856
324 nmdc:mga0yw44_343493_c1
325 nmdc:mga08y16_52985_c1
326 Ga0495601_1040377
327 Ga0495595_0682533
328 Ga0495619_0879619
329 Ga0500591_090395
330 Ga0500658_0352778
331 Ga0500568_0005839
332 Ga0500616_0000913
333 Ga0500624_138908
334 Ga0501084_0002658
335 Ga0501082_0020439
336 8001784667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

15

61

0.98

PF12840

HTH_20

Helix-turn-helix domain

13

62

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9611 2 83
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.943 2 86
6j0e-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9229 5 80
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9217 5 78
3f6v-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulator for arsenical resistance 0.9203 7 83
ID Description Score Start End Superfamily
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9499 2 81 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.946 2 78 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9347 11 67 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9333 2 80 1.10.10.10
3f6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9203 7 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2W5VFY7-F1-model_v4 HTH arsR-type domain-containing protein 0.9869 2 81 GO:0003700
AF-A0A7Y0KPA5-F1-model_v4 Metalloregulator ArsR/SmtB family transcription factor 0.9798 3 81 GO:0003700
AF-A0A4Q3GMU9-F1-model_v4 deleted 0.9784 1 84
AF-A0A1H8CRU2-F1-model_v4 Transcriptional regulator, ArsR family 0.9781 3 83 GO:0003700
AF-A0A2U1T230-F1-model_v4 Transcriptional regulator 0.9766 1 87 GO:0003700

Map