F252141

General Info

Members Datasets Scaffolds Average Seq Length
168 90 167 300

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100275883|Ga0070662_1002758832
Length 312
Sequence MPERDDATRERVGTEPWRSVLPPGFSWPDGYRAAACFTFDVDAESPILFDHPEAAAWLDVMSHQAYGPRTAMPRLLRLLDRAAVPATFFVPGYSAERWADAVRAIRDAGHEIAHHGYVHEGARSAPDVETEERRLVRGLEALDAVLGVRPIGYRGPNWEISYATPGLLAKHGFRYDTGLMDADHPYRLAVSAEPNAPSIIELPAHWSLDDWEPYNYLPGITGSGVIASPADVIARWTLELEALVEEGGLFMLTNHPFVSGRASRAAGLGRLIARAQEIDGLWIATAAEIAAHVETLPLEPVVHRPPELPPAI

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
51 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
52 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
53 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
54 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
55 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
58 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
59 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
60 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
61 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
62 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
63 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
64 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
65 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
66 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
67 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
68 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
69 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
73 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
74 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
75 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
76 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
77 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
78 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
80 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
81 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
82 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
83 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
86 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
87 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
88 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
89 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
90 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 21.43
Rhizosphere 77.38
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10116166 3300003316 Bacteria 2017
2 Ga0065707_10098577 3300005295 Bacteria 3074
3 Ga0070683_100200468 3300005329 Bacteria 1895
4 Ga0070680_100000022 3300005336 Bacteria 81256
5 Ga0070687_100097137 3300005343 Bacteria 1641
6 Ga0070703_10021563 3300005406 Unclassified 1884
7 Ga0070705_100006478 3300005440 Bacteria 5743
8 Ga0070705_100009080 3300005440 Bacteria 4935
9 Ga0070705_100082494 3300005440 Bacteria 1978
10 Ga0070708_100001973 3300005445 Bacteria 15822
11 Ga0070708_100034308 3300005445 Bacteria 4414
12 Ga0070708_100053763 3300005445 Bacteria 3575
13 Ga0070708_100081233 3300005445 Bacteria 2934
14 Ga0070708_100086382 3300005445 Bacteria 2849
15 Ga0070708_100122109 3300005445 Bacteria 2404
16 Ga0070708_100148517 3300005445 Bacteria 2178
17 Ga0070708_100516160 3300005445 Bacteria 1127
18 Ga0070662_100275883 3300005457 Bacteria 1359
19 Ga0070685_10292876 3300005466 Unclassified 1094
20 Ga0070706_100021743 3300005467 Bacteria 5906
21 Ga0070706_100124573 3300005467 Bacteria 2402
22 Ga0070706_100176830 3300005467 Bacteria 1993
23 Ga0070706_100187369 3300005467 Bacteria 1933
24 Ga0070706_100481965 3300005467 Bacteria 1154
25 Ga0070707_100025199 3300005468 Bacteria 5641
26 Ga0070707_100027947 3300005468 Bacteria 5366
27 Ga0070707_100047007 3300005468 Bacteria 4130
28 Ga0070707_100102062 3300005468 Bacteria 2780
29 Ga0070707_100107463 3300005468 Bacteria 2707
30 Ga0070707_100261767 3300005468 Bacteria 1683
31 Ga0070707_100728048 3300005468 Bacteria 955
32 Ga0070698_100006120 3300005471 Bacteria 13102
33 Ga0070698_100014519 3300005471 Bacteria 8315
34 Ga0070698_100029741 3300005471 Bacteria 5669
35 Ga0070698_100098998 3300005471 Bacteria 2889
36 Ga0070699_100001197 3300005518 Bacteria 23950
37 Ga0070697_100001514 3300005536 Bacteria 17654
38 Ga0070697_100004169 3300005536 Bacteria 11076
39 Ga0070697_100188137 3300005536 Bacteria 1752
40 Ga0070697_100285819 3300005536 Bacteria 1416
41 Ga0070686_100054166 3300005544 Unclassified 2565
42 Ga0070686_100157215 3300005544 Bacteria 1598
43 Ga0070695_100009514 3300005545 Bacteria 5789
44 Ga0070695_100062369 3300005545 Bacteria 2420
45 Ga0070695_100064911 3300005545 Bacteria 2376
46 Ga0070695_100105141 3300005545 Bacteria 1907
47 Ga0070696_100004405 3300005546 Bacteria 9399
48 Ga0070696_100009478 3300005546 Bacteria 6522
49 Ga0070696_100023501 3300005546 Bacteria 4191
50 Ga0070696_100042023 3300005546 Unclassified 3160
51 Ga0070696_100049101 3300005546 Bacteria 2930
52 Ga0070696_100127411 3300005546 Bacteria 1849
53 Ga0070704_100019823 3300005549 Bacteria 4326
54 Ga0070704_100055365 3300005549 Bacteria 2812
55 Ga0070704_100085157 3300005549 Bacteria 2339
56 Ga0068854_100313320 3300005578 Bacteria 1273
57 Ga0070702_100209156 3300005615 Bacteria 1297
58 Ga0068864_100015490 3300005618 Bacteria 6339
59 Ga0068858_100175032 3300005842 Bacteria 2025
60 Ga0081539_10008454 3300005985 Bacteria 8960
61 Ga0075428_100001083 3300006844 Bacteria 28968
62 Ga0075431_100687690 3300006847 Bacteria 1001
63 Ga0075433_10028667 3300006852 Bacteria 4736
64 Ga0075433_10051934 3300006852 Bacteria 3571
65 Ga0075434_100051569 3300006871 Bacteria 4089
66 Ga0075434_100131137 3300006871 Bacteria 2525
67 Ga0075435_100057332 3300007076 Bacteria 3151
68 Ga0075435_100166012 3300007076 Bacteria 1861
69 Ga0105245_10158423 3300009098 Bacteria 2146
70 Ga0114129_10000236 3300009147 Bacteria 61673
71 Ga0114129_10017339 3300009147 Bacteria 10252
72 Ga0114129_10037708 3300009147 Bacteria 6823
73 Ga0105243_10108273 3300009148 Bacteria 2319
74 Ga0105248_10384642 3300009177 Bacteria 1580
75 Ga0105239_10127544 3300010375 Unclassified 2829
76 Ga0105246_10013911 3300011119 Bacteria 5051
77 Ga0163163_10047999 3300014325 Bacteria 4197
78 Ga0163163_10063503 3300014325 Bacteria 3662
79 Ga0163163_10183598 3300014325 Bacteria 2139
80 Ga0157377_10182248 3300014745 Unclassified 1321
81 Ga0157379_10020251 3300014968 Bacteria 5881
82 Ga0157379_10487069 3300014968 Bacteria 1142
83 Ga0207653_10008836 3300025885 Bacteria 3141
84 Ga0207684_10075234 3300025910 Bacteria 2870
85 Ga0207684_10221424 3300025910 Bacteria 1633
86 Ga0207693_10323634 3300025915 Bacteria 1207
87 Ga0207660_10000004 3300025917 Bacteria 371608
88 Ga0207662_10043455 3300025918 Bacteria 2650
89 Ga0207646_10002753 3300025922 Bacteria 20555
90 Ga0207646_10055995 3300025922 Bacteria 3525
91 Ga0207646_10068174 3300025922 Bacteria 3178
92 Ga0207646_10115736 3300025922 Bacteria 2408
93 Ga0207646_10317165 3300025922 Bacteria 1408
94 Ga0207646_10327852 3300025922 Bacteria 1383
95 Ga0207665_10097172 3300025939 Bacteria 2050
96 Ga0207640_10412432 3300025981 Bacteria 1103
97 Ga0207708_10438943 3300026075 Bacteria 1085
98 Ga0207676_10020186 3300026095 Bacteria 4871
99 Ga0207675_100471427 3300026118 Bacteria 1246
100 Ga0265320_10076688 3300031240 Unclassified 1566
101 Ga0265329_10003242 3300031242 Bacteria 7130
102 Ga0307415_100197479 3300032126 Unclassified 1593
103 Ga0373947_0069209 3300035725 Bacteria 2160
104 Ga0373937_0386615 3300036401 Bacteria 1327
105 Ga0373925_0015117 3300037068 Bacteria 5580
106 Ga0395900_0303225 3300037418 Bacteria 1583
107 Ga0242420_018928 3300038996 Bacteria 1217
108 Ga0436365_0059628 3300039437 Bacteria 2542
109 Ga0495584_0138649 3300046491 Bacteria 1235
110 Ga0495676_0164651 3300047321 Bacteria 1566
111 Ga0495593_0133088 3300047673 Bacteria 1262
112 Ga0496100_0021344 3300048903 Bacteria 3897
113 Ga0496100_0279804 3300048903 Unclassified 1243
114 Ga0496101_0020982 3300048904 Bacteria 4483
115 Ga0496101_0038822 3300048904 Unclassified 3383
116 Ga0496101_0404026 3300048904 Bacteria 1076
117 Ga0496102_0181995 3300048905 Unclassified 1980
118 Ga0496103_0040945 3300048906 Unclassified 2848
119 Ga0496103_0043207 3300048906 Bacteria 2774
120 Ga0496104_0020780 3300048907 Bacteria 6021
121 Ga0496104_0091051 3300048907 Bacteria 2915
122 Ga0496104_0117155 3300048907 Bacteria 2556
123 Ga0496105_0006409 3300048908 Bacteria 9045
124 Ga0496105_0521610 3300048908 Bacteria 930
125 Ga0496106_0029417 3300048909 Bacteria 4094
126 Ga0496106_0179853 3300048909 Bacteria 1679
127 Ga0496106_0334756 3300048909 Unclassified 1215
128 Ga0496107_0606195 3300048910 Bacteria 809
129 Ga0496108_0017691 3300048911 Bacteria 5831
130 Ga0496108_0153134 3300048911 Bacteria 1990
131 Ga0496108_0180438 3300048911 Unclassified 1828
132 Ga0496109_0009740 3300048912 Bacteria 8202
133 Ga0496109_0009931 3300048912 Bacteria 8128
134 Ga0496109_0284122 3300048912 Bacteria 1559
135 Ga0496109_0408853 3300048912 Bacteria 1282
136 Ga0496110_0005901 3300048913 Bacteria 9639
137 Ga0496111_0002036 3300048914 Bacteria 12029
138 Ga0496111_0382807 3300048914 Unclassified 1040
139 Ga0496112_0000024 3300048915 Bacteria 154372
140 Ga0496112_0146061 3300048915 Bacteria 2333
141 Ga0496112_0185016 3300048915 Bacteria 2047
142 Ga0496113_0002006 3300048916 Bacteria 11675
143 Ga0496113_0036007 3300048916 Bacteria 3624
144 Ga0496114_0000635 3300048917 Bacteria 25937
145 Ga0496114_0008536 3300048917 Bacteria 8121
146 Ga0496114_0030784 3300048917 Bacteria 4416
147 Ga0496115_0028587 3300048918 Bacteria 4371
148 Ga0501040_0197947 3300049576 Bacteria 1426
149 Ga0501067_0002902 3300049583 Bacteria 9441
150 Ga0501067_0063779 3300049583 Bacteria 2040
151 Ga0501067_0182702 3300049583 Bacteria 1168
152 Ga0501068_0055094 3300049584 Unclassified 2409
153 Ga0501069_0020612 3300049585 Bacteria 3573
154 Ga0501069_0179409 3300049585 Bacteria 1224
155 Ga0501070_0141942 3300049586 Bacteria 1983
156 Ga0501081_0099071 3300049743 Bacteria 2059
157 nmdc:mga05p37_1230_c1 3300050507 Bacteria 29689
158 nmdc:mga05p37_54495_c1 3300050507 Bacteria 4920
159 nmdc:mga0n895_118820_c1 3300050512 Bacteria 2664
160 nmdc:mga0n895_150805_c1 3300050512 Bacteria 2355
161 nmdc:mga0n895_617234_c1 3300050512 Bacteria 1085
162 nmdc:mga0rr50_517507_c1 3300050513 Bacteria 1015
163 nmdc:mga08x19_163715_c1 3300050514 Bacteria 1511
164 nmdc:mga0a205_183725_c1 3300050515 Bacteria 1985
165 nmdc:mga0a205_61877_c1 3300050515 Unclassified 3616
166 nmdc:mga0a205_71202_c1 3300050515 Bacteria 3358
167 Ga0495612_0000537 3300053078 Bacteria 15264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048910 Ga0496107_0606195 Ga0496107_0606195_37_798 248
2 3300048909 Ga0496106_0179853 Ga0496106_0179853_895_1653 249
3 3300038996 Ga0242420_018928 Ga0242420_018928_397_1206 267
4 3300005343 Ga0070687_100097137 Ga0070687_1000971371 281
5 3300031242 Ga0265329_10003242 Ga0265329_100032423 286
6 3300037068 Ga0373925_0015117 Ga0373925_0015117_1806_2672 286
7 3300046491 Ga0495584_0138649 Ga0495584_0138649_359_1225 286
8 3300005440 Ga0070705_100009080 Ga0070705_1000090802 287
9 3300005468 Ga0070707_100107463 Ga0070707_1001074632 287
10 3300005985 Ga0081539_10008454 Ga0081539_100084543 287
11 3300025922 Ga0207646_10327852 Ga0207646_103278522 287
12 3300037418 Ga0395900_0303225 Ga0395900_0303225_544_1416 287
13 3300048904 Ga0496101_0404026 Ga0496101_0404026_183_1052 287
14 3300048906 Ga0496103_0043207 Ga0496103_0043207_28_897 287
15 3300048907 Ga0496104_0091051 Ga0496104_0091051_181_1050 287
16 3300048909 Ga0496106_0029417 Ga0496106_0029417_2585_3454 287
17 3300048915 Ga0496112_0185016 Ga0496112_0185016_544_1413 287
18 3300048912 Ga0496109_0408853 Ga0496109_0408853_65_946 288
19 3300005336 Ga0070680_100000022 Ga0070680_10000002240 289
20 3300005445 Ga0070708_100001973 Ga0070708_10000197313 289
21 3300005468 Ga0070707_100102062 Ga0070707_1001020621 289
22 3300005471 Ga0070698_100098998 Ga0070698_1000989982 289
23 3300005518 Ga0070699_100001197 Ga0070699_10000119714 289
24 3300005536 Ga0070697_100004169 Ga0070697_1000041699 289
25 3300005618 Ga0068864_100015490 Ga0068864_1000154902 289
26 3300014325 Ga0163163_10183598 Ga0163163_101835982 289
27 3300025917 Ga0207660_10000004 Ga0207660_1000000475 289
28 3300026095 Ga0207676_10020186 Ga0207676_100201864 289
29 3300036401 Ga0373937_0386615 Ga0373937_0386615_203_1084 289
30 3300049586 Ga0501070_0141942 Ga0501070_0141942_1087_1956 289
31 3300050512 nmdc:mga0n895_617234_c1 nmdc:mga0n895_617234_c1_175_1056 289
32 iso_pu_bacteria 8057798959 8057799147 289
33 3300048903 Ga0496100_0279804 Ga0496100_0279804_106_1020 290
34 3300048904 Ga0496101_0020982 Ga0496101_0020982_2182_3096 290
35 3300048905 Ga0496102_0181995 Ga0496102_0181995_999_1913 290
36 3300048911 Ga0496108_0180438 Ga0496108_0180438_432_1346 290
37 3300005536 Ga0070697_100001514 Ga0070697_1000015147 293
38 3300009098 Ga0105245_10158423 Ga0105245_101584232 293
39 3300009177 Ga0105248_10384642 Ga0105248_103846422 293
40 3300010375 Ga0105239_10127544 Ga0105239_101275442 293
41 3300014745 Ga0157377_10182248 Ga0157377_101822482 293
42 3300048909 Ga0496106_0334756 Ga0496106_0334756_63_986 293
43 3300048917 Ga0496114_0008536 Ga0496114_0008536_2740_3663 293
44 3300048918 Ga0496115_0028587 Ga0496115_0028587_124_1047 293
45 3300049576 Ga0501040_0197947 Ga0501040_0197947_150_1073 293
46 3300049583 Ga0501067_0063779 Ga0501067_0063779_656_1570 293
47 3300049585 Ga0501069_0020612 Ga0501069_0020612_2340_3239 293
48 3300049743 Ga0501081_0099071 Ga0501081_0099071_850_1773 293
49 3300005471 Ga0070698_100029741 Ga0070698_1000297416 294
50 3300031240 Ga0265320_10076688 Ga0265320_100766882 294
51 3300005467 Ga0070706_100187369 Ga0070706_1001873692 295
52 3300025885 Ga0207653_10008836 Ga0207653_100088362 295
53 3300025910 Ga0207684_10221424 Ga0207684_102214241 295
54 3300025915 Ga0207693_10323634 Ga0207693_103236342 295
55 3300025939 Ga0207665_10097172 Ga0207665_100971722 295
56 3300035725 Ga0373947_0069209 Ga0373947_0069209_445_1338 295
57 3300047673 Ga0495593_0133088 Ga0495593_0133088_199_1092 295
58 3300048907 Ga0496104_0117155 Ga0496104_0117155_1014_1907 295
59 3300048908 Ga0496105_0521610 Ga0496105_0521610_17_910 295
60 3300048911 Ga0496108_0153134 Ga0496108_0153134_89_982 295
61 3300048912 Ga0496109_0009931 Ga0496109_0009931_3758_4651 295
62 3300048916 Ga0496113_0036007 Ga0496113_0036007_2719_3612 295
63 3300005329 Ga0070683_100200468 Ga0070683_1002004682 296
64 3300005406 Ga0070703_10021563 Ga0070703_100215631 296
65 3300005440 Ga0070705_100082494 Ga0070705_1000824942 296
66 3300005445 Ga0070708_100053763 Ga0070708_1000537632 296
67 3300005445 Ga0070708_100081233 Ga0070708_1000812333 296
68 3300005445 Ga0070708_100086382 Ga0070708_1000863823 296
69 3300005445 Ga0070708_100148517 Ga0070708_1001485172 296
70 3300005466 Ga0070685_10292876 Ga0070685_102928762 296
71 3300005468 Ga0070707_100047007 Ga0070707_1000470072 296
72 3300005468 Ga0070707_100261767 Ga0070707_1002617672 296
73 3300005545 Ga0070695_100009514 Ga0070695_1000095142 296
74 3300005546 Ga0070696_100042023 Ga0070696_1000420232 296
75 3300005546 Ga0070696_100127411 Ga0070696_1001274112 296
76 3300005549 Ga0070704_100019823 Ga0070704_1000198234 296
77 3300005549 Ga0070704_100055365 Ga0070704_1000553653 296
78 3300005615 Ga0070702_100209156 Ga0070702_1002091562 296
79 3300006852 Ga0075433_10051934 Ga0075433_100519342 296
80 3300025922 Ga0207646_10002753 Ga0207646_100027533 296
81 3300025922 Ga0207646_10055995 Ga0207646_100559952 296
82 3300025922 Ga0207646_10317165 Ga0207646_103171652 296
83 3300047321 Ga0495676_0164651 Ga0495676_0164651_448_1344 296
84 3300048906 Ga0496103_0040945 Ga0496103_0040945_581_1477 296
85 3300050515 nmdc:mga0a205_183725_c1 nmdc:mga0a205_183725_c1_1018_1914 296
86 3300005295 Ga0065707_10098577 Ga0065707_100985773 297
87 3300005445 Ga0070708_100122109 Ga0070708_1001221092 297
88 3300005445 Ga0070708_100516160 Ga0070708_1005161601 297
89 3300005467 Ga0070706_100481965 Ga0070706_1004819651 297
90 3300005468 Ga0070707_100728048 Ga0070707_1007280481 297
91 3300005471 Ga0070698_100014519 Ga0070698_1000145195 297
92 3300005545 Ga0070695_100062369 Ga0070695_1000623692 297
93 3300005546 Ga0070696_100049101 Ga0070696_1000491012 297
94 3300005578 Ga0068854_100313320 Ga0068854_1003133202 297
95 3300006844 Ga0075428_100001083 Ga0075428_10000108320 297
96 3300006852 Ga0075433_10028667 Ga0075433_100286672 297
97 3300006871 Ga0075434_100131137 Ga0075434_1001311372 297
98 3300009147 Ga0114129_10000236 Ga0114129_1000023617 297
99 3300009148 Ga0105243_10108273 Ga0105243_101082732 297
100 3300014968 Ga0157379_10020251 Ga0157379_100202514 297
101 3300025981 Ga0207640_10412432 Ga0207640_104124321 297
102 3300026075 Ga0207708_10438943 Ga0207708_104389432 297
103 3300049584 Ga0501068_0055094 Ga0501068_0055094_26_925 297
104 3300050507 nmdc:mga05p37_1230_c1 nmdc:mga05p37_1230_c1_26882_27781 297
105 3300050514 nmdc:mga08x19_163715_c1 nmdc:mga08x19_163715_c1_97_999 297
106 3300053078 Ga0495612_0000537 Ga0495612_0000537_13910_14809 297
107 3300005440 Ga0070705_100006478 Ga0070705_1000064782 298
108 3300005545 Ga0070695_100105141 Ga0070695_1001051412 298
109 3300005546 Ga0070696_100004405 Ga0070696_1000044059 298
110 3300005546 Ga0070696_100009478 Ga0070696_1000094787 298
111 3300005842 Ga0068858_100175032 Ga0068858_1001750322 298
112 3300007076 Ga0075435_100057332 Ga0075435_1000573323 298
113 3300009147 Ga0114129_10017339 Ga0114129_100173393 298
114 3300009147 Ga0114129_10037708 Ga0114129_100377086 298
115 3300014325 Ga0163163_10063503 Ga0163163_100635032 298
116 3300014968 Ga0157379_10487069 Ga0157379_104870691 298
117 3300032126 Ga0307415_100197479 Ga0307415_1001974793 298
118 3300039437 Ga0436365_0059628 Ga0436365_0059628_1148_2050 298
119 3300048908 Ga0496105_0006409 Ga0496105_0006409_3195_4118 298
120 3300048911 Ga0496108_0017691 Ga0496108_0017691_4652_5575 298
121 3300048912 Ga0496109_0284122 Ga0496109_0284122_257_1180 298
122 3300048913 Ga0496110_0005901 Ga0496110_0005901_6272_7195 298
123 3300048914 Ga0496111_0002036 Ga0496111_0002036_4130_5053 298
124 3300048915 Ga0496112_0146061 Ga0496112_0146061_1282_2205 298
125 3300048916 Ga0496113_0002006 Ga0496113_0002006_1522_2445 298
126 3300048917 Ga0496114_0030784 Ga0496114_0030784_1421_2344 298
127 3300050507 nmdc:mga05p37_54495_c1 nmdc:mga05p37_54495_c1_3265_4173 298
128 3300050515 nmdc:mga0a205_61877_c1 nmdc:mga0a205_61877_c1_1472_2374 298
129 3300005546 Ga0070696_100023501 Ga0070696_1000235014 299
130 3300006847 Ga0075431_100687690 Ga0075431_1006876901 299
131 3300014325 Ga0163163_10047999 Ga0163163_100479993 299
132 3300026118 Ga0207675_100471427 Ga0207675_1004714271 299
133 3300048903 Ga0496100_0021344 Ga0496100_0021344_1987_2898 299
134 3300048904 Ga0496101_0038822 Ga0496101_0038822_1422_2333 299
135 3300048907 Ga0496104_0020780 Ga0496104_0020780_608_1519 299
136 3300048912 Ga0496109_0009740 Ga0496109_0009740_4613_5524 299
137 3300048914 Ga0496111_0382807 Ga0496111_0382807_45_956 299
138 3300048917 Ga0496114_0000635 Ga0496114_0000635_1206_2117 299
139 3300050512 nmdc:mga0n895_150805_c1 nmdc:mga0n895_150805_c1_543_1451 299
140 3300050513 nmdc:mga0rr50_517507_c1 nmdc:mga0rr50_517507_c1_13_921 299
141 3300003316 rootH1_10116166 rootH1_101161662 300
142 3300005445 Ga0070708_100034308 Ga0070708_1000343082 300
143 3300005457 Ga0070662_100275883 Ga0070662_1002758832 300
144 3300005467 Ga0070706_100021743 Ga0070706_1000217432 300
145 3300005467 Ga0070706_100124573 Ga0070706_1001245732 300
146 3300005467 Ga0070706_100176830 Ga0070706_1001768302 300
147 3300005468 Ga0070707_100025199 Ga0070707_1000251994 300
148 3300005468 Ga0070707_100027947 Ga0070707_1000279472 300
149 3300005471 Ga0070698_100006120 Ga0070698_10000612012 300
150 3300005536 Ga0070697_100188137 Ga0070697_1001881372 300
151 3300005536 Ga0070697_100285819 Ga0070697_1002858192 300
152 3300005544 Ga0070686_100054166 Ga0070686_1000541661 300
153 3300005544 Ga0070686_100157215 Ga0070686_1001572151 300
154 3300005545 Ga0070695_100064911 Ga0070695_1000649111 300
155 3300005549 Ga0070704_100085157 Ga0070704_1000851572 300
156 3300006871 Ga0075434_100051569 Ga0075434_1000515693 300
157 3300007076 Ga0075435_100166012 Ga0075435_1001660122 300
158 3300011119 Ga0105246_10013911 Ga0105246_100139115 300
159 3300025910 Ga0207684_10075234 Ga0207684_100752342 300
160 3300025918 Ga0207662_10043455 Ga0207662_100434552 300
161 3300025922 Ga0207646_10068174 Ga0207646_100681742 300
162 3300025922 Ga0207646_10115736 Ga0207646_101157362 300
163 3300048915 Ga0496112_0000024 Ga0496112_0000024_80909_81832 300
164 3300049583 Ga0501067_0002902 Ga0501067_0002902_8529_9431 300
165 3300049583 Ga0501067_0182702 Ga0501067_0182702_219_1157 300
166 3300049585 Ga0501069_0179409 Ga0501069_0179409_89_1027 300
167 3300050512 nmdc:mga0n895_118820_c1 nmdc:mga0n895_118820_c1_806_1732 300
168 3300050515 nmdc:mga0a205_71202_c1 nmdc:mga0a205_71202_c1_2190_3116 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

65

175

0.96

PF10096

DUF2334

Uncharacterized protein conserved in bacteria (DUF2334)

72

275

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rxz-assembly1.cif.gz_B crystal structure of putative polysaccharide deacetylase from mycobacterium smegmatis 0.9733 16 296
3rxz-assembly1.cif.gz_B crystal structure of putative polysaccharide deacetylase from mycobacterium smegmatis 0.9465 16 296
3qbu-assembly1.cif.gz_C crystal structure of putative peptidoglycan deactelyase (hp0310) from helicobacter pylori 0.9007 22 280
3cl6-assembly1.cif.gz_A crystal structure of puue allantoinase 0.8633 18 288
1z7a-assembly1.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8618 18 281
ID Description Score Start End Superfamily
3rxzD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9568 16 297 3.20.20.370
3rxzD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.93 16 297 3.20.20.370
3qbuB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9007 22 280 3.20.20.370
af_O13842_2_320_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8604 18 284 3.20.20.370
2j13A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8472 25 281 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A1A1WYS5-F1-model_v4 deleted 0.9815 16 299
AF-A0A6J4IBY0-F1-model_v4 Polysaccharide deacetylase 0.9724 21 283 GO:0005975
GO:0016810
AF-A0A538A312-F1-model_v4 Polysaccharide deacetylase 0.9713 52 298 GO:0005975
GO:0016810
AF-A0A2A3FUS2-F1-model_v4 Polysaccharide deacetylase 0.9693 21 291 GO:0005975
GO:0016810
AF-A0A5N9GUW0-F1-model_v4 NodB homology domain-containing protein 0.9689 16 114 GO:0005975
GO:0016810

Feature Viewer

pLDDT pTM Quality
92.81 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map