F251886

General Info

Members Datasets Scaffolds Average Seq Length
168 92 336 261

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100396972|Ga0070683_1003969722
Length 275
Sequence MLLCLDIGNSQIHGGVFDGELLRCQFRKTTKTPDSADELGIFFTAVLRENGVDPRAVKRVAICSVVPAALHSLRGAAVKYFHCEPFVLQAGVKTGLKVRYRNPHEVGADRIAGAIAATRRYPKQDLLVVDCGTATTVEVVTAGGDYLGGVILPGVGVSASALATNTAKLPRVEIAPPENVLGRTTVESIQSGLYHGHVGAIRHILAALKSEAFPSSKPRVIGTGGFSRMFEREGLFDEIIPELVLWGLKYADGMNYEPETELGTKTLGARATSPA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
15 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
22 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
23 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
24 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
25 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
26 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
27 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
28 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
29 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
30 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
31 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
32 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
33 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
34 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
35 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
36 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
39 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
40 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
41 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
42 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
45 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
46 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
47 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
48 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
49 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
50 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
51 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
52 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
53 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
54 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
55 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
56 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
57 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
58 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
59 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
60 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
74 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
75 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
76 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
77 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
78 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
79 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
80 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
81 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
82 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
85 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
88 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
89 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
90 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
91 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
92 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 2.38
Rhizosphere 93.45
Stem 0
Stem Tuber 0
Unclassified 6.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100396972 3300005329 Unclassified 1315
2 SwRhRL2b_contig_1580706 2162886007 Bacteria 45709
3 rootH2_10040914 3300003320 Bacteria 5454
4 rootL2_10139182 3300003322 Bacteria 11410
5 Ga0065704_10070148 3300005289 Bacteria 264542
6 Ga0070658_10022102 3300005327 Bacteria 5103
7 Ga0070683_100300242 3300005329 Bacteria 1528
8 Ga0070713_100012046 3300005436 Bacteria 6332
9 Ga0070706_100149568 3300005467 Bacteria 2180
10 Ga0070679_100010131 3300005530 Bacteria 8937
11 Ga0068853_100378981 3300005539 Bacteria 1321
12 Ga0068856_100009963 3300005614 Bacteria 9228
13 Ga0068856_100241078 3300005614 Bacteria 1823
14 Ga0075434_100227578 3300006871 Bacteria 1884
15 Ga0075434_100320652 3300006871 Bacteria 1570
16 Ga0105240_10981101 3300009093 Unclassified 905
17 Ga0105239_10008693 3300010375 Bacteria 11496
18 Ga0207705_10013103 3300025909 Bacteria 5984
19 Ga0207652_10015735 3300025921 Bacteria 6161
20 Ga0207700_10008516 3300025928 Bacteria 6362
21 Ga0207661_10036441 3300025944 Bacteria 3840
22 Ga0207661_10367171 3300025944 Bacteria 1301
23 Ga0207639_10329508 3300026041 Bacteria 1358
24 Ga0207702_10031815 3300026078 Bacteria 4400
25 Ga0265337_1000484 3300028556 Bacteria 21075
26 Ga0265326_10052451 3300028558 Bacteria 1154
27 Ga0265319_1000298 3300028563 Bacteria 36808
28 Ga0265319_1004029 3300028563 Bacteria 7440
29 Ga0265319_1005242 3300028563 Bacteria 6254
30 Ga0265319_1006231 3300028563 Bacteria 5556
31 Ga0265319_1009533 3300028563 Bacteria 4127
32 Ga0265319_1009544 3300028563 Bacteria 4124
33 Ga0265319_1011954 3300028563 Bacteria 3529
34 Ga0265319_1030587 3300028563 Bacteria 1881
35 Ga0265334_10004498 3300028573 Bacteria 6184
36 Ga0265334_10006098 3300028573 Bacteria 5228
37 Ga0265318_10000004 3300028577 Bacteria 319325
38 Ga0265318_10001248 3300028577 Bacteria 15423
39 Ga0265318_10003033 3300028577 Bacteria 8650
40 Ga0265318_10012181 3300028577 Bacteria 3670
41 Ga0265318_10017279 3300028577 Bacteria 2963
42 Ga0265318_10099154 3300028577 Bacteria 1072
43 Ga0265318_10191344 3300028577 Bacteria 749
44 Ga0265323_10104359 3300028653 Bacteria 935
45 Ga0265336_10014386 3300028666 Bacteria 2623
46 Ga0265338_10000199 3300028800 Bacteria 113221
47 Ga0265338_10034233 3300028800 Bacteria 4914
48 Ga0265338_10046168 3300028800 Bacteria 3994
49 Ga0265324_10001523 3300029957 Bacteria 13046
50 Ga0265324_10038673 3300029957 Bacteria 1654
51 Ga0265332_10103206 3300031238 Bacteria 1202
52 Ga0265328_10013152 3300031239 Bacteria 3281
53 Ga0265328_10037974 3300031239 Bacteria 1778
54 Ga0265320_10000113 3300031240 Bacteria 70098
55 Ga0265320_10000885 3300031240 Bacteria 22562
56 Ga0265320_10003537 3300031240 Bacteria 10462
57 Ga0265320_10006554 3300031240 Bacteria 7324
58 Ga0265320_10007411 3300031240 Bacteria 6812
59 Ga0265320_10072770 3300031240 Bacteria 1616
60 Ga0265320_10114227 3300031240 Bacteria 1235
61 Ga0265325_10018310 3300031241 Bacteria 3884
62 Ga0265325_10043834 3300031241 Bacteria 2333
63 Ga0265325_10096305 3300031241 Unclassified 1454
64 Ga0265340_10070753 3300031247 Unclassified 1654
65 Ga0265339_10143263 3300031249 Bacteria 1214
66 Ga0265331_10008849 3300031250 Bacteria 5699
67 Ga0265331_10012539 3300031250 Bacteria 4585
68 Ga0265327_10000091 3300031251 Bacteria 196369
69 Ga0265327_10001907 3300031251 Bacteria 24075
70 Ga0265327_10014232 3300031251 Bacteria 5214
71 Ga0265327_10084520 3300031251 Bacteria 1559
72 Ga0265316_10013135 3300031344 Bacteria 7377
73 Ga0265316_10023000 3300031344 Bacteria 5243
74 Ga0265316_10027772 3300031344 Bacteria 4679
75 Ga0265313_10000192 3300031595 Bacteria 65204
76 Ga0265313_10000784 3300031595 Bacteria 32118
77 Ga0265313_10014788 3300031595 Bacteria 4588
78 Ga0265313_10068738 3300031595 Bacteria 1636
79 Ga0307508_10000093 3300031616 Bacteria 104212
80 Ga0265314_10000714 3300031711 Bacteria 40123
81 Ga0265314_10002023 3300031711 Bacteria 21514
82 Ga0265314_10016797 3300031711 Bacteria 5767
83 Ga0265314_10141665 3300031711 Bacteria 1485
84 Ga0265314_10277003 3300031711 Bacteria 951
85 Ga0265342_10033857 3300031712 Bacteria 3137
86 Ga0265342_10038404 3300031712 Bacteria 2916
87 Ga0307410_10304207 3300031852 Bacteria 1259
88 Ga0307406_10651484 3300031901 Bacteria 874
89 Ga0307412_10643753 3300031911 Bacteria 903
90 Ga0316583_10017828 3300032133 Bacteria 2551
91 Ga0373937_0456187 3300036401 Unclassified 1214
92 Ga0395905_0000054 3300037471 Bacteria 210118
93 Ga0395905_0000146 3300037471 Bacteria 116742
94 Ga0400489_71071 3300039093 Bacteria 9114
95 Ga0451577_0000889 3300042876 Bacteria 44337
96 Ga0451577_0322762 3300042876 Bacteria 1400
97 Ga0453683_0328479 3300044673 Bacteria 981
98 Ga0466961_0034000 3300044693 Bacteria 3275
99 Ga0453684_0015090 3300044712 Bacteria 12260
100 Ga0453684_0033573 3300044712 Bacteria 7150
101 Ga0453684_0050570 3300044712 Bacteria 5464
102 Ga0451576_0029782 3300045051 Bacteria 5840
103 Ga0451576_0314710 3300045051 Bacteria 1638
104 Ga0451576_0492114 3300045051 Bacteria 1288
105 Ga0451576_0555896 3300045051 Bacteria 1206
106 Ga0495656_0002965 3300046615 Bacteria 5696
107 Ga0495636_0079371 3300047318 Bacteria 1411
108 Ga0495615_0056804 3300048090 Bacteria 1023
109 Ga0496110_0002523 3300048913 Bacteria 13754
110 Ga0496110_0082362 3300048913 Bacteria 2870
111 Ga0496110_0188298 3300048913 Bacteria 1874
112 Ga0496110_0406090 3300048913 Bacteria 1242
113 Ga0496124_0000001 3300048927 Bacteria 1747840
114 Ga0501031_0047734 3300049568 Bacteria 2791
115 Ga0501032_0001073 3300049569 Bacteria 21880
116 Ga0501032_0013712 3300049569 Bacteria 5754
117 Ga0501032_0028889 3300049569 Unclassified 3808
118 Ga0501033_0001042 3300049570 Bacteria 25266
119 Ga0501033_0373605 3300049570 Bacteria 996
120 Ga0501034_0136443 3300049571 Bacteria 2434
121 Ga0501034_0280512 3300049571 Bacteria 1605
122 Ga0501036_0000211 3300049572 Bacteria 39073
123 Ga0501036_0145348 3300049572 Bacteria 2000
124 Ga0501037_0021254 3300049573 Bacteria 4795
125 Ga0501037_0042341 3300049573 Bacteria 3346
126 Ga0501038_0041152 3300049574 Unclassified 4030
127 Ga0501039_0006365 3300049575 Bacteria 8969
128 Ga0501042_0324054 3300049578 Bacteria 1113
129 Ga0501043_0001786 3300049579 Bacteria 18490
130 Ga0501043_0049767 3300049579 Bacteria 3295
131 Ga0501043_0072132 3300049579 Bacteria 2713
132 Ga0501046_0006156 3300049580 Bacteria 10658
133 Ga0501046_0025925 3300049580 Bacteria 4791
134 Ga0501046_0027958 3300049580 Bacteria 4596
135 Ga0501046_0059799 3300049580 Bacteria 2984
136 Ga0501047_0040876 3300049581 Bacteria 4483
137 Ga0501047_0047774 3300049581 Bacteria 4134
138 Ga0501047_0252142 3300049581 Bacteria 1613
139 Ga0501047_0600202 3300049581 Bacteria 922
140 Ga0501048_0082984 3300049582 Unclassified 2260
141 Ga0501048_0107133 3300049582 Bacteria 1973
142 Ga0501067_0001540 3300049583 Bacteria 12565
143 Ga0501068_0000846 3300049584 Bacteria 15936
144 Ga0501069_0001091 3300049585 Bacteria 13075
145 Ga0501070_0448627 3300049586 Bacteria 1040
146 Ga0501072_0002333 3300049588 Bacteria 14236
147 Ga0501073_0026886 3300049589 Unclassified 4119
148 Ga0501074_0102320 3300049590 Bacteria 2050
149 Ga0501076_0026988 3300049592 Unclassified 4453
150 Ga0501077_0009291 3300049593 Bacteria 6103
151 Ga0501079_0031599 3300049741 Unclassified 4069
152 Ga0501080_0000193 3300049742 Bacteria 44520
153 Ga0501083_0004075 3300049744 Bacteria 10279
154 Ga0501083_0015411 3300049744 Bacteria 5353
155 Ga0501083_0053287 3300049744 Bacteria 2716
156 Ga0501083_0202760 3300049744 Bacteria 1293
157 Ga0501035_0002661 3300049822 Bacteria 17376
158 Ga0501035_0004070 3300049822 Bacteria 13906
159 Ga0501035_0176805 3300049822 Bacteria 1841
160 Ga0501044_0000206 3300049823 Bacteria 75006
161 Ga0501044_0005798 3300049823 Bacteria 13678
162 Ga0501044_0103663 3300049823 Bacteria 2859
163 Ga0501045_0038691 3300049824 Bacteria 3470
164 nmdc:mga0n895_179176_c1 3300050512 Bacteria 2150
165 Ga0500593_055966 3300053117 Bacteria 1742
166 Ga0500568_0025615 3300053139 Bacteria 2486
167 Ga0501084_0021080 3300054114 Bacteria 5435
168 Ga0501082_0008135 3300060353 Bacteria 9048
169 Ga0070683_100396972
170 SwRhRL2b_contig_1580706
171 rootH2_10040914
172 rootL2_10139182
173 Ga0065704_10070148
174 Ga0070658_10022102
175 Ga0070683_100300242
176 Ga0070713_100012046
177 Ga0070706_100149568
178 Ga0070679_100010131
179 Ga0068853_100378981
180 Ga0068856_100009963
181 Ga0068856_100241078
182 Ga0075434_100227578
183 Ga0075434_100320652
184 Ga0105240_10981101
185 Ga0105239_10008693
186 Ga0207705_10013103
187 Ga0207652_10015735
188 Ga0207700_10008516
189 Ga0207661_10036441
190 Ga0207661_10367171
191 Ga0207639_10329508
192 Ga0207702_10031815
193 Ga0265337_1000484
194 Ga0265326_10052451
195 Ga0265319_1000298
196 Ga0265319_1004029
197 Ga0265319_1005242
198 Ga0265319_1006231
199 Ga0265319_1009533
200 Ga0265319_1009544
201 Ga0265319_1011954
202 Ga0265319_1030587
203 Ga0265334_10004498
204 Ga0265334_10006098
205 Ga0265318_10000004
206 Ga0265318_10001248
207 Ga0265318_10003033
208 Ga0265318_10012181
209 Ga0265318_10017279
210 Ga0265318_10099154
211 Ga0265318_10191344
212 Ga0265323_10104359
213 Ga0265336_10014386
214 Ga0265338_10000199
215 Ga0265338_10034233
216 Ga0265338_10046168
217 Ga0265324_10001523
218 Ga0265324_10038673
219 Ga0265332_10103206
220 Ga0265328_10013152
221 Ga0265328_10037974
222 Ga0265320_10000113
223 Ga0265320_10000885
224 Ga0265320_10003537
225 Ga0265320_10006554
226 Ga0265320_10007411
227 Ga0265320_10072770
228 Ga0265320_10114227
229 Ga0265325_10018310
230 Ga0265325_10043834
231 Ga0265325_10096305
232 Ga0265340_10070753
233 Ga0265339_10143263
234 Ga0265331_10008849
235 Ga0265331_10012539
236 Ga0265327_10000091
237 Ga0265327_10001907
238 Ga0265327_10014232
239 Ga0265327_10084520
240 Ga0265316_10013135
241 Ga0265316_10023000
242 Ga0265316_10027772
243 Ga0265313_10000192
244 Ga0265313_10000784
245 Ga0265313_10014788
246 Ga0265313_10068738
247 Ga0307508_10000093
248 Ga0265314_10000714
249 Ga0265314_10002023
250 Ga0265314_10016797
251 Ga0265314_10141665
252 Ga0265314_10277003
253 Ga0265342_10033857
254 Ga0265342_10038404
255 Ga0307410_10304207
256 Ga0307406_10651484
257 Ga0307412_10643753
258 Ga0316583_10017828
259 Ga0373937_0456187
260 Ga0395905_0000054
261 Ga0395905_0000146
262 Ga0400489_71071
263 Ga0451577_0000889
264 Ga0451577_0322762
265 Ga0453683_0328479
266 Ga0466961_0034000
267 Ga0453684_0015090
268 Ga0453684_0033573
269 Ga0453684_0050570
270 Ga0451576_0029782
271 Ga0451576_0314710
272 Ga0451576_0492114
273 Ga0451576_0555896
274 Ga0495656_0002965
275 Ga0495636_0079371
276 Ga0495615_0056804
277 Ga0496110_0002523
278 Ga0496110_0082362
279 Ga0496110_0188298
280 Ga0496110_0406090
281 Ga0496124_0000001
282 Ga0501031_0047734
283 Ga0501032_0001073
284 Ga0501032_0013712
285 Ga0501032_0028889
286 Ga0501033_0001042
287 Ga0501033_0373605
288 Ga0501034_0136443
289 Ga0501034_0280512
290 Ga0501036_0000211
291 Ga0501036_0145348
292 Ga0501037_0021254
293 Ga0501037_0042341
294 Ga0501038_0041152
295 Ga0501039_0006365
296 Ga0501042_0324054
297 Ga0501043_0001786
298 Ga0501043_0049767
299 Ga0501043_0072132
300 Ga0501046_0006156
301 Ga0501046_0025925
302 Ga0501046_0027958
303 Ga0501046_0059799
304 Ga0501047_0040876
305 Ga0501047_0047774
306 Ga0501047_0252142
307 Ga0501047_0600202
308 Ga0501048_0082984
309 Ga0501048_0107133
310 Ga0501067_0001540
311 Ga0501068_0000846
312 Ga0501069_0001091
313 Ga0501070_0448627
314 Ga0501072_0002333
315 Ga0501073_0026886
316 Ga0501074_0102320
317 Ga0501076_0026988
318 Ga0501077_0009291
319 Ga0501079_0031599
320 Ga0501080_0000193
321 Ga0501083_0004075
322 Ga0501083_0015411
323 Ga0501083_0053287
324 Ga0501083_0202760
325 Ga0501035_0002661
326 Ga0501035_0004070
327 Ga0501035_0176805
328 Ga0501044_0000206
329 Ga0501044_0005798
330 Ga0501044_0103663
331 Ga0501045_0038691
332 nmdc:mga0n895_179176_c1
333 Ga0500593_055966
334 Ga0500568_0025615
335 Ga0501084_0021080
336 Ga0501082_0008135

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03309

Pan_kinase

Type III pantothenate kinase

2

207

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3djc-assembly2.cif.gz_E crystal structure of pantothenate kinase from legionella pneumophila 0.9846 1 256
3djc-assembly2.cif.gz_D crystal structure of pantothenate kinase from legionella pneumophila 0.9828 2 256
3djc-assembly1.cif.gz_K crystal structure of pantothenate kinase from legionella pneumophila 0.9815 1 256
3djc-assembly1.cif.gz_L crystal structure of pantothenate kinase from legionella pneumophila 0.9808 1 256
3djc-assembly1.cif.gz_K crystal structure of pantothenate kinase from legionella pneumophila 0.9776 1 256
ID Description Score Start End Superfamily
3djcB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9827 2 88 3.30.420.40
3djcJ02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9753 89 256 3.30.420.40
3djcJ02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9695 89 256 3.30.420.40
2h3gX01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9659 1 87 3.30.420.40
3djcB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.95 2 88 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A3B9XGI8-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) 0.9898 1 135 GO:0004594
GO:0005524
GO:0005737
GO:0015937
AF-A0A535J5I2-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) 0.9883 1 83 GO:0004594
GO:0005524
GO:0005737
GO:0015937
AF-A0A1G0H7J3-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) 0.9855 1 255 GO:0004594
GO:0005524
GO:0005737
GO:0015937
GO:0046872
AF-A0A5K7ZSU1-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) 0.9845 1 256 GO:0004594
GO:0005524
GO:0005737
GO:0015937
AF-A0A0W0W234-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) 0.9831 1 256 GO:0004594
GO:0005524
GO:0005737
GO:0015937
GO:0046872

Map