F251429

General Info

Members Datasets Scaffolds Average Seq Length
167 126 334 290

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_3459_c1|nmdc:mga08x19_3459_c1_1864_2856
Length 319
Sequence MPPASLRKSLFPAFVHQSRTWLRRCPVLLLVSLSGCSGGVLEPQGPIGAANRIILLDSLAIMGVIVVPTLAAILAFAWWFRASNPRAVYRPDFVYEGRLELLVWAVPILIIMFLGGVIWIGSQQLDPFRPIDAQTGQAAQKPLEVQVISLDWKWLFIYPDRNVASVNQVVVPAGTPVHFLLTSASVMNQFFVPQLGSMIACMNRMVTQLHLQADRPGNYNGLSAQFSGDGFSTMHFVLRAVPRDEFDAWIAGARRSGPTLDRAGYTALAQPSERVSPFTYSAVEPGLFAAVATQEIPPGPGPSAEAGPTQIRPKTKTDH

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
68 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
73 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
76 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
77 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
78 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
79 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
89 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
120 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
121 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
122 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
123 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
124 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
125 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
126 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 0.6
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.19
Nodule 0.6
Rhizoplane 2.99
Rhizosphere 82.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_3459_c1 3300050514 Bacteria 9414
2 JGI25404J52841_10009583 3300003659 Bacteria 2072
3 Ga0070658_10194190 3300005327 Bacteria 1712
4 Ga0070668_100008050 3300005347 Bacteria 7830
5 Ga0070671_100419147 3300005355 Bacteria 1146
6 Ga0070709_10000143 3300005434 Bacteria 47770
7 Ga0070710_10000126 3300005437 Bacteria 35287
8 Ga0070662_100023297 3300005457 Bacteria 4251
9 Ga0070681_10185679 3300005458 Bacteria 2000
10 Ga0070696_100144884 3300005546 Bacteria 1739
11 Ga0070665_100130434 3300005548 Bacteria 2516
12 Ga0068856_100198081 3300005614 Bacteria 2023
13 Ga0068860_100000071 3300005843 Bacteria 178413
14 Ga0068862_100008858 3300005844 Bacteria 8328
15 Ga0081540_1001251 3300005983 Bacteria 22199
16 Ga0081540_1008378 3300005983 Bacteria 7227
17 Ga0081540_1011399 3300005983 Bacteria 5943
18 Ga0081540_1011569 3300005983 Bacteria 5891
19 Ga0081540_1012584 3300005983 Bacteria 5558
20 Ga0081540_1023735 3300005983 Bacteria 3577
21 Ga0081540_1045912 3300005983 Bacteria 2212
22 Ga0081540_1061382 3300005983 Bacteria 1792
23 Ga0081539_10004520 3300005985 Bacteria 15282
24 Ga0070717_10278963 3300006028 Bacteria 1482
25 Ga0075432_10006574 3300006058 Bacteria 3958
26 Ga0075432_10025093 3300006058 Bacteria 2044
27 Ga0070715_10060746 3300006163 Bacteria 1658
28 Ga0070712_100044449 3300006175 Bacteria 3063
29 Ga0075362_10050138 3300006177 Bacteria 1866
30 Ga0075427_10000601 3300006194 Bacteria 4211
31 Ga0075428_100588292 3300006844 Bacteria 1189
32 Ga0075431_100045466 3300006847 Bacteria 4527
33 Ga0075433_10012513 3300006852 Bacteria 6860
34 Ga0075433_10097044 3300006852 Bacteria 2609
35 Ga0075433_10128542 3300006852 Bacteria 2251
36 Ga0075434_100026393 3300006871 Bacteria 5690
37 Ga0075434_100088388 3300006871 Bacteria 3099
38 Ga0075434_100200231 3300006871 Bacteria 2017
39 Ga0075429_100003161 3300006880 Bacteria 13997
40 Ga0075436_100099774 3300006914 Bacteria 2022
41 Ga0075435_100087623 3300007076 Bacteria 2565
42 Ga0099794_10139694 3300007265 Bacteria 1226
43 Ga0111539_10120103 3300009094 Bacteria 3079
44 Ga0105245_10173088 3300009098 Bacteria 2057
45 Ga0105247_10121711 3300009101 Bacteria 1691
46 Ga0114129_10150672 3300009147 Bacteria 3183
47 Ga0114129_10154038 3300009147 Bacteria 3144
48 Ga0114129_10429668 3300009147 Bacteria 1735
49 Ga0105243_10123315 3300009148 Bacteria 2188
50 Ga0105243_10489350 3300009148 Bacteria 1163
51 Ga0105249_10019911 3300009553 Bacteria 5992
52 Ga0105249_10054885 3300009553 Bacteria 3644
53 Ga0157370_10290643 3300013104 Bacteria 1510
54 Ga0157370_10400790 3300013104 Bacteria 1263
55 Ga0157374_10117405 3300013296 Bacteria 2564
56 Ga0157378_10588497 3300013297 Bacteria 1122
57 Ga0163162_10050816 3300013306 Bacteria 4158
58 Ga0157375_10230281 3300013308 Bacteria 2012
59 Ga0163163_10188335 3300014325 Bacteria 2112
60 Ga0163163_10437708 3300014325 Bacteria 1367
61 Ga0182008_10069756 3300014497 Bacteria 1729
62 Ga0163161_10282012 3300017792 Bacteria 1303
63 Ga0213876_10044882 3300021384 Bacteria 2337
64 Ga0213875_10000009 3300021388 Bacteria 451129
65 Ga0213871_10028772 3300021441 Bacteria 1436
66 Ga0224712_10022525 3300022467 Bacteria 2173
67 Ga0207692_10000427 3300025898 Bacteria 14774
68 Ga0207685_10012701 3300025905 Bacteria 2579
69 Ga0207699_10000213 3300025906 Bacteria 34254
70 Ga0207705_10171051 3300025909 Bacteria 1636
71 Ga0207693_10052773 3300025915 Bacteria 3189
72 Ga0207693_10220027 3300025915 Bacteria 1492
73 Ga0207663_10000933 3300025916 Bacteria 13325
74 Ga0207663_10166270 3300025916 Bacteria 1562
75 Ga0207681_10020935 3300025923 Bacteria 4151
76 Ga0207664_10114449 3300025929 Bacteria 2248
77 Ga0207644_10229365 3300025931 Bacteria 1475
78 Ga0207670_10159712 3300025936 Bacteria 1681
79 Ga0207712_10005237 3300025961 Bacteria 8203
80 Ga0207712_10505083 3300025961 Bacteria 1034
81 Ga0207668_10010796 3300025972 Bacteria 5531
82 Ga0207677_10444958 3300026023 Bacteria 1109
83 Ga0207702_10171369 3300026078 Bacteria 1991
84 Ga0207675_100009794 3300026118 Bacteria 8969
85 Ga0207428_10000733 3300027907 Bacteria 37786
86 Ga0268265_10004213 3300028380 Bacteria 10051
87 Ga0268264_10000073 3300028381 Bacteria 260615
88 Ga0307511_10030723 3300030521 Bacteria 4819
89 Ga0265332_10000201 3300031238 Bacteria 48394
90 Ga0265325_10075551 3300031241 Bacteria 1683
91 Ga0307513_10045809 3300031456 Bacteria 4776
92 Ga0307508_10181235 3300031616 Bacteria 1708
93 Ga0316578_10027469 3300031728 Bacteria 3217
94 Ga0316583_10002400 3300032133 Bacteria 6477
95 Ga0307507_10012192 3300033179 Bacteria 10667
96 Ga0373938_0025139 3300034957 Bacteria 1237
97 Ga0373928_0029243 3300035084 Bacteria 1211
98 Ga0373940_0005359 3300035088 Bacteria 2773
99 Ga0373944_0063944 3300035089 Bacteria 1186
100 Ga0373941_0150104 3300035115 Bacteria 854
101 Ga0373931_0001206 3300035691 Bacteria 11056
102 Ga0373935_0027075 3300035692 Bacteria 3544
103 Ga0373935_0261852 3300035692 Bacteria 1213
104 Ga0373927_0019614 3300035695 Bacteria 4432
105 Ga0373927_0132320 3300035695 Bacteria 1630
106 Ga0373927_0162031 3300035695 Bacteria 1465
107 Ga0373947_0041532 3300035725 Bacteria 2742
108 Ga0316582_0021912 3300036647 Bacteria 3784
109 Ga0373925_0126703 3300037068 Bacteria 1987
110 Ga0436364_0038683 3300037853 Bacteria 1854
111 Ga0436364_0063485 3300037853 Bacteria 24575
112 Ga0436364_0362032 3300037853 Bacteria 2794
113 Ga0436364_0557166 3300037853 Bacteria 1744
114 Ga0436364_0651451 3300037853 Bacteria 1535
115 Ga0436365_0947453 3300039437 Bacteria 15265
116 Ga0436360_0069933 3300039438 Bacteria 1105
117 Ga0436360_0273210 3300039438 Bacteria 1164
118 Ga0436360_0732396 3300039438 Bacteria 3269
119 Ga0436360_0961624 3300039438 Bacteria 2113
120 Ga0436361_1190226 3300039447 Bacteria 2286
121 Ga0436363_1358284 3300039450 Bacteria 1792
122 Ga0436363_1588431 3300039450 Bacteria 1330
123 Ga0436362_1122674 3300039453 Bacteria 2002
124 Ga0466959_0080204 3300045049 Bacteria 2353
125 Ga0466967_0100034 3300045976 Bacteria 2649
126 Ga0466967_0908266 3300045976 Bacteria 876
127 Ga0495664_0093645 3300046477 Bacteria 1808
128 Ga0495584_0100241 3300046491 Bacteria 1464
129 Ga0495606_0001928 3300046507 Bacteria 25740
130 Ga0495630_0371545 3300046517 Bacteria 1095
131 Ga0495622_0044343 3300046557 Bacteria 2067
132 Ga0495634_0118032 3300046642 Bacteria 1701
133 Ga0495613_0141205 3300046689 Bacteria 1721
134 Ga0495624_0099013 3300046690 Bacteria 1795
135 Ga0495672_0104564 3300047320 Bacteria 1530
136 Ga0495614_0144570 3300048089 Bacteria 1058
137 Ga0496101_0650632 3300048904 Bacteria 833
138 Ga0496102_0369602 3300048905 Bacteria 1350
139 Ga0496105_0240206 3300048908 Bacteria 1470
140 Ga0496108_0163664 3300048911 Bacteria 1923
141 Ga0496114_0355093 3300048917 Bacteria 1297
142 Ga0496117_0190737 3300048920 Bacteria 1168
143 Ga0496126_0020008 3300048929 Bacteria 6575
144 nmdc:mga05p37_157621_c1 3300050507 Bacteria 2774
145 nmdc:mga05p37_331945_c1 3300050507 Bacteria 1796
146 nmdc:mga05p37_686197_c1 3300050507 Bacteria 1140
147 nmdc:mga05p37_8115_c1 3300050507 Bacteria 12409
148 nmdc:mga09592_20429_c1 3300050508 Bacteria 5445
149 nmdc:mga09592_381247_c1 3300050508 Bacteria 1219
150 nmdc:mga0qj67_16606_c1 3300050509 Bacteria 5587
151 nmdc:mga06r32_115467_c1 3300050510 Bacteria 2644
152 nmdc:mga06r32_5267_c1 3300050510 Bacteria 11635
153 nmdc:mga08y16_8471_c1 3300050511 Bacteria 10771
154 nmdc:mga0n895_14853_c1 3300050512 Bacteria 7087
155 nmdc:mga0n895_28327_c1 3300050512 Bacteria 5327
156 nmdc:mga0rr50_9486_c1 3300050513 Bacteria 6121
157 nmdc:mga0a205_138946_c1 3300050515 Bacteria 1157
158 nmdc:mga0a205_163499_c1 3300050515 Bacteria 2122
159 nmdc:mga0a205_6392_c1 3300050515 Bacteria 10644
160 Ga0500635_0033531 3300053080 Bacteria 1675
161 Ga0500566_0018447 3300053094 Bacteria 4097
162 Ga0500597_119320 3300053120 Bacteria 1143
163 Ga0500603_012974 3300053150 Bacteria 1924
164 Ga0500636_0022170 3300053177 Bacteria 3757
165 Ga0500552_019676 3300053733 Bacteria 948
166 2824663970 2824661429 Bacteria 9877870
167 2904695310 2904690495 Bacteria 9412302
168 nmdc:mga08x19_3459_c1
169 JGI25404J52841_10009583
170 Ga0070658_10194190
171 Ga0070668_100008050
172 Ga0070671_100419147
173 Ga0070709_10000143
174 Ga0070710_10000126
175 Ga0070662_100023297
176 Ga0070681_10185679
177 Ga0070696_100144884
178 Ga0070665_100130434
179 Ga0068856_100198081
180 Ga0068860_100000071
181 Ga0068862_100008858
182 Ga0081540_1001251
183 Ga0081540_1008378
184 Ga0081540_1011399
185 Ga0081540_1011569
186 Ga0081540_1012584
187 Ga0081540_1023735
188 Ga0081540_1045912
189 Ga0081540_1061382
190 Ga0081539_10004520
191 Ga0070717_10278963
192 Ga0075432_10006574
193 Ga0075432_10025093
194 Ga0070715_10060746
195 Ga0070712_100044449
196 Ga0075362_10050138
197 Ga0075427_10000601
198 Ga0075428_100588292
199 Ga0075431_100045466
200 Ga0075433_10012513
201 Ga0075433_10097044
202 Ga0075433_10128542
203 Ga0075434_100026393
204 Ga0075434_100088388
205 Ga0075434_100200231
206 Ga0075429_100003161
207 Ga0075436_100099774
208 Ga0075435_100087623
209 Ga0099794_10139694
210 Ga0111539_10120103
211 Ga0105245_10173088
212 Ga0105247_10121711
213 Ga0114129_10150672
214 Ga0114129_10154038
215 Ga0114129_10429668
216 Ga0105243_10123315
217 Ga0105243_10489350
218 Ga0105249_10019911
219 Ga0105249_10054885
220 Ga0157370_10290643
221 Ga0157370_10400790
222 Ga0157374_10117405
223 Ga0157378_10588497
224 Ga0163162_10050816
225 Ga0157375_10230281
226 Ga0163163_10188335
227 Ga0163163_10437708
228 Ga0182008_10069756
229 Ga0163161_10282012
230 Ga0213876_10044882
231 Ga0213875_10000009
232 Ga0213871_10028772
233 Ga0224712_10022525
234 Ga0207692_10000427
235 Ga0207685_10012701
236 Ga0207699_10000213
237 Ga0207705_10171051
238 Ga0207693_10052773
239 Ga0207693_10220027
240 Ga0207663_10000933
241 Ga0207663_10166270
242 Ga0207681_10020935
243 Ga0207664_10114449
244 Ga0207644_10229365
245 Ga0207670_10159712
246 Ga0207712_10005237
247 Ga0207712_10505083
248 Ga0207668_10010796
249 Ga0207677_10444958
250 Ga0207702_10171369
251 Ga0207675_100009794
252 Ga0207428_10000733
253 Ga0268265_10004213
254 Ga0268264_10000073
255 Ga0307511_10030723
256 Ga0265332_10000201
257 Ga0265325_10075551
258 Ga0307513_10045809
259 Ga0307508_10181235
260 Ga0316578_10027469
261 Ga0316583_10002400
262 Ga0307507_10012192
263 Ga0373938_0025139
264 Ga0373928_0029243
265 Ga0373940_0005359
266 Ga0373944_0063944
267 Ga0373941_0150104
268 Ga0373931_0001206
269 Ga0373935_0027075
270 Ga0373935_0261852
271 Ga0373927_0019614
272 Ga0373927_0132320
273 Ga0373927_0162031
274 Ga0373947_0041532
275 Ga0316582_0021912
276 Ga0373925_0126703
277 Ga0436364_0038683
278 Ga0436364_0063485
279 Ga0436364_0362032
280 Ga0436364_0557166
281 Ga0436364_0651451
282 Ga0436365_0947453
283 Ga0436360_0069933
284 Ga0436360_0273210
285 Ga0436360_0732396
286 Ga0436360_0961624
287 Ga0436361_1190226
288 Ga0436363_1358284
289 Ga0436363_1588431
290 Ga0436362_1122674
291 Ga0466959_0080204
292 Ga0466967_0100034
293 Ga0466967_0908266
294 Ga0495664_0093645
295 Ga0495584_0100241
296 Ga0495606_0001928
297 Ga0495630_0371545
298 Ga0495622_0044343
299 Ga0495634_0118032
300 Ga0495613_0141205
301 Ga0495624_0099013
302 Ga0495672_0104564
303 Ga0495614_0144570
304 Ga0496101_0650632
305 Ga0496102_0369602
306 Ga0496105_0240206
307 Ga0496108_0163664
308 Ga0496114_0355093
309 Ga0496117_0190737
310 Ga0496126_0020008
311 nmdc:mga05p37_157621_c1
312 nmdc:mga05p37_331945_c1
313 nmdc:mga05p37_686197_c1
314 nmdc:mga05p37_8115_c1
315 nmdc:mga09592_20429_c1
316 nmdc:mga09592_381247_c1
317 nmdc:mga0qj67_16606_c1
318 nmdc:mga06r32_115467_c1
319 nmdc:mga06r32_5267_c1
320 nmdc:mga08y16_8471_c1
321 nmdc:mga0n895_14853_c1
322 nmdc:mga0n895_28327_c1
323 nmdc:mga0rr50_9486_c1
324 nmdc:mga0a205_138946_c1
325 nmdc:mga0a205_163499_c1
326 nmdc:mga0a205_6392_c1
327 Ga0500635_0033531
328 Ga0500566_0018447
329 Ga0500597_119320
330 Ga0500603_012974
331 Ga0500636_0022170
332 Ga0500552_019676
333 2824663970
334 2904695310

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

159

241

0.95

PF06481

COX_ARM

COX Aromatic Rich Motif

254

299

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cyx-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa) 0.9443 119 273
1cyw-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii) (cyoa) 0.9397 119 272
1cyx-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa) 0.9212 119 273
8gym-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.9111 146 227
7w5z-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model 0.9096 146 227
ID Description Score Start End Superfamily
af_P0ABJ1_113_282_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9589 108 272 2.60.40.420
af_Q2FZJ9_108_266_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9489 112 260 2.60.40.420
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9379 146 227 2.60.40.420
af_P0ABJ1_113_282_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9261 108 272 2.60.40.420
5wehH02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9204 119 228 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A527XK88-F1-model_v4 Cytochrome ubiquinol oxidase subunit II 0.9758 118 200 GO:0004129
GO:0005507
GO:0005886
GO:0042773
AF-A0A434RHB5-F1-model_v4 Cytochrome ubiquinol oxidase subunit II 0.97 116 273 GO:0004129
GO:0005507
GO:0005886
GO:0009486
GO:0042773
AF-A0A527XK88-F1-model_v4 Cytochrome ubiquinol oxidase subunit II 0.9644 118 200 GO:0004129
GO:0005507
GO:0005886
GO:0042773
AF-A0A1F8JDM8-F1-model_v4 deleted 0.9605 121 274
AF-A0A3D4PXL4-F1-model_v4 Cytochrome c oxidase subunit II 0.9523 145 230 GO:0004129
GO:0005507
GO:0016020
GO:0042773

Map