F251386

General Info

Members Datasets Scaffolds Average Seq Length
167 127 158 301

Family's Representative Sequence

Representative Sequence 3300049673|Ga0501240_006635|Ga0501240_006635_130_1146
Length 338
Sequence MFRIVPRNEHDLPTRAENRARAMTPKPDAREMTDRRACFDFEVDFSNGGGIQGQGFRLDIDGDDIDDDALAAYIIQDLRLLMVGEVRILNKRIIEERHKRATRAADXXXXDDHGELIDLSHTIEDGMITYKGLPAPLICDHLSREKSRTVYAEGTEFQIGRIDMVANTGTYIDTPFHRYAHGHDLAGLPLVKASGLPGVVVRLEGFEGRAIDWHAFAATDVKGKAVLVQTGWDRHWRTDAYFEGHPFLTEKAALYLRDNGAELVGIDSFNIDDVSGGERPVHSVLLGAGIPIVEHMTALSRLPVHGFRFWAVPPKVAGMGTFPVRAHARVGKNSAQSS

Samples

Sample ID Description Type Environment
1 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
2 2643221695 Lysobacter sp. Root494 Isolate Unclassified
3 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
4 2841760612 Bosea sp. Tri-49 Isolate Nodule
5 2844104063 Bosea sp. Tri-39 Isolate Nodule
6 2851246043 Bosea sp. Tri-54 Isolate Nodule
7 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
77 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
78 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
88 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
89 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
97 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
100 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
111 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
122 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
123 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
124 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
127 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.61
Metatranscriptomes 0
Isolates 5.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.78
Nodule 2.4
Rhizoplane 4.19
Rhizosphere 77.84
Stem 0
Stem Tuber 0
Unclassified 7.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10009159 3300002244 Bacteria 1632
2 JGI25165J46597_1000020 3300003214 Bacteria 370477
3 JGI25153J46596_10000005 3300003215 Bacteria 492839
4 rootH1_10009664 3300003316 Bacteria 2131
5 Ga0065165_1006200 3300005262 Bacteria 6380
6 Ga0070658_10001768 3300005327 Bacteria 18176
7 Ga0070658_10027606 3300005327 Bacteria 4553
8 Ga0070676_10060115 3300005328 Bacteria 2256
9 Ga0070670_100431844 3300005331 Bacteria 1165
10 Ga0070666_10000007 3300005335 Bacteria 293732
11 Ga0070666_10033871 3300005335 Bacteria 3384
12 Ga0070668_100109541 3300005347 Bacteria 2197
13 Ga0070668_100258082 3300005347 Bacteria 1449
14 Ga0070668_100319568 3300005347 Bacteria 1307
15 Ga0070668_100337863 3300005347 Bacteria 1272
16 Ga0070671_100039229 3300005355 Bacteria 3931
17 Ga0070671_100461288 3300005355 Bacteria 1090
18 Ga0070667_100113350 3300005367 Bacteria 2353
19 Ga0070667_100336830 3300005367 Bacteria 1364
20 Ga0070711_100046395 3300005439 Bacteria 2960
21 Ga0070663_100427270 3300005455 Bacteria 1088
22 Ga0070681_10033644 3300005458 Bacteria 5146
23 Ga0070665_100041081 3300005548 Bacteria 4648
24 Ga0070665_100056619 3300005548 Bacteria 3931
25 Ga0070665_100161025 3300005548 Bacteria 2246
26 Ga0070665_100186439 3300005548 Bacteria 2075
27 Ga0070665_100221283 3300005548 Bacteria 1893
28 Ga0070704_100255167 3300005549 Bacteria 1442
29 Ga0068856_100023499 3300005614 Bacteria 5994
30 Ga0068856_100027613 3300005614 Bacteria 5537
31 Ga0070702_100088388 3300005615 Bacteria 1873
32 Ga0068859_100002524 3300005617 Bacteria 18569
33 Ga0068859_100005258 3300005617 Bacteria 13154
34 Ga0068859_100032277 3300005617 Bacteria 5260
35 Ga0068861_100047945 3300005719 Bacteria 3227
36 Ga0068851_10042037 3300005834 Bacteria 2300
37 Ga0068863_100022185 3300005841 Bacteria 6061
38 Ga0068858_100023654 3300005842 Bacteria 5723
39 Ga0068858_100034194 3300005842 Bacteria 4714
40 Ga0068860_100039313 3300005843 Bacteria 4524
41 Ga0068860_100069902 3300005843 Bacteria 3338
42 Ga0068862_100001858 3300005844 Bacteria 19137
43 Ga0081538_10046705 3300005981 Bacteria 2666
44 Ga0097621_100311431 3300006237 Bacteria 1393
45 Ga0068871_100026760 3300006358 Bacteria 4504
46 Ga0097620_100002524 3300006931 Bacteria 18569
47 Ga0097620_100005258 3300006931 Bacteria 13154
48 Ga0097620_100032278 3300006931 Bacteria 5260
49 Ga0111539_10293148 3300009094 Bacteria 1893
50 Ga0105247_10002114 3300009101 Bacteria 13737
51 Ga0105248_10002800 3300009177 Bacteria 19383
52 Ga0105248_10254515 3300009177 Bacteria 1976
53 Ga0105237_10016500 3300009545 Bacteria 7672
54 Ga0105238_10000179 3300009551 Bacteria 69276
55 Ga0105249_10048088 3300009553 Bacteria 3889
56 Ga0105249_10546445 3300009553 Bacteria 1208
57 Ga0105239_10409043 3300010375 Bacteria 1536
58 Ga0157374_10188502 3300013296 Bacteria 2017
59 Ga0163162_10021868 3300013306 Bacteria 6302
60 Ga0163162_10375593 3300013306 Bacteria 1555
61 Ga0163163_10082875 3300014325 Bacteria 3212
62 Ga0157379_10061014 3300014968 Bacteria 3372
63 Ga0157379_10157789 3300014968 Bacteria 2047
64 Ga0157376_10010571 3300014969 Bacteria 6758
65 Ga0157376_10089114 3300014969 Bacteria 2667
66 Ga0209233_1000047 3300025261 Bacteria 459614
67 Ga0209233_1007654 3300025261 Bacteria 3403
68 Ga0209676_1008705 3300025292 Bacteria 4481
69 Ga0209758_1000001 3300025297 Bacteria 1981790
70 Ga0209257_1003653 3300025304 Bacteria 12906
71 Ga0207710_10005363 3300025900 Bacteria 5532
72 Ga0207680_10000002 3300025903 Bacteria 1018646
73 Ga0207705_10008875 3300025909 Bacteria 7327
74 Ga0207707_10008453 3300025912 Bacteria 8928
75 Ga0207671_10074593 3300025914 Bacteria 2535
76 Ga0207663_10012720 3300025916 Bacteria 4557
77 Ga0207694_10000369 3300025924 Bacteria 42083
78 Ga0207644_10012207 3300025931 Bacteria 5701
79 Ga0207711_10004281 3300025941 Bacteria 12193
80 Ga0207711_10235400 3300025941 Bacteria 1678
81 Ga0207712_10019717 3300025961 Bacteria 4407
82 Ga0207668_10083064 3300025972 Bacteria 2330
83 Ga0207658_10066122 3300025986 Bacteria 2718
84 Ga0207658_10125055 3300025986 Bacteria 2056
85 Ga0207658_10281373 3300025986 Bacteria 1426
86 Ga0207703_10025077 3300026035 Bacteria 4690
87 Ga0207703_10100969 3300026035 Bacteria 2446
88 Ga0207639_10669706 3300026041 Bacteria 961
89 Ga0207678_10014027 3300026067 Bacteria 7046
90 Ga0207702_10068614 3300026078 Bacteria 3046
91 Ga0207641_10060622 3300026088 Bacteria 3225
92 Ga0207641_10092303 3300026088 Bacteria 2651
93 Ga0207683_10269012 3300026121 Bacteria 1557
94 Ga0268266_10000004 3300028379 Bacteria 1495817
95 Ga0268266_10163981 3300028379 Bacteria 2012
96 Ga0268265_10001878 3300028380 Bacteria 16707
97 Ga0268264_10033549 3300028381 Bacteria 4219
98 Ga0268264_10067503 3300028381 Bacteria 3019
99 Ga0268264_10084590 3300028381 Bacteria 2720
100 Ga0268264_10381845 3300028381 Bacteria 1349
101 Ga0307515_10014436 3300028794 Bacteria 14642
102 Ga0307511_10000259 3300030521 Bacteria 54621
103 Ga0316182_1220337 3300030745 Bacteria 2340
104 Ga0307516_10008414 3300031730 Bacteria 11694
105 Ga0307405_10309012 3300031731 Bacteria 1203
106 Ga0307405_10385520 3300031731 Bacteria 1092
107 Ga0307413_10214381 3300031824 Bacteria 1401
108 Ga0307410_10058866 3300031852 Bacteria 2621
109 Ga0307407_10135041 3300031903 Bacteria 1584
110 Ga0307416_100120868 3300032002 Bacteria 2334
111 Ga0307416_100329234 3300032002 Bacteria 1534
112 Ga0307414_10190909 3300032004 Bacteria 1657
113 Ga0307411_10005661 3300032005 Bacteria 6166
114 Ga0373933_0139246 3300035724 Bacteria 1531
115 Ga0439432_010298 3300042006 Bacteria 3243
116 Ga0439449_0006389 3300042007 Bacteria 4508
117 Ga0439449_0017572 3300042007 Bacteria 2686
118 Ga0450908_000019 3300042184 Bacteria 38415
119 Ga0466961_0272311 3300044693 Bacteria 1037
120 Ga0466959_0082350 3300045049 Bacteria 2318
121 Ga0495629_0042595 3300046459 Bacteria 3190
122 Ga0495638_0148650 3300046460 Bacteria 1361
123 Ga0495650_0001675 3300046471 Bacteria 20469
124 Ga0495650_0002264 3300046471 Bacteria 16065
125 Ga0495650_0063565 3300046471 Bacteria 1471
126 Ga0495583_0011675 3300046506 Bacteria 5031
127 Ga0495583_0013987 3300046506 Bacteria 4445
128 Ga0495616_0016361 3300046513 Bacteria 4107
129 Ga0495609_0044757 3300046538 Bacteria 1985
130 Ga0495625_0001137 3300046660 Bacteria 34397
131 Ga0495660_0000008 3300046810 Bacteria 435769
132 Ga0495687_001488 3300047443 Bacteria 21400
133 Ga0496101_0008623 3300048904 Bacteria 6666
134 Ga0496102_0063488 3300048905 Bacteria 3382
135 Ga0496106_0316894 3300048909 Bacteria 1252
136 Ga0496108_0047366 3300048911 Bacteria 3593
137 Ga0496110_0186913 3300048913 Bacteria 1881
138 Ga0496112_0552234 3300048915 Bacteria 1085
139 Ga0496113_0003084 3300048916 Bacteria 9898
140 Ga0496118_0020885 3300048921 Bacteria 5791
141 Ga0496121_0041539 3300048924 Bacteria 4017
142 Ga0496124_0097489 3300048927 Bacteria 2387
143 Ga0496125_0028028 3300048928 Bacteria 5094
144 Ga0496126_0039008 3300048929 Bacteria 4413
145 Ga0501046_0334184 3300049580 Bacteria 1102
146 Ga0501069_0071348 3300049585 Bacteria 1947
147 Ga0501070_0145575 3300049586 Bacteria 1956
148 Ga0501073_0083747 3300049589 Bacteria 2219
149 Ga0501074_0182035 3300049590 Bacteria 1499
150 Ga0501240_006635 3300049673 Bacteria 1430
151 Ga0501035_0259344 3300049822 Bacteria 1474
152 nmdc:mga08y16_525312_c1 3300050511 Bacteria 1200
153 Ga0500568_0004776 3300053139 Bacteria 7172
154 Ga0500568_0029675 3300053139 Bacteria 2267
155 Ga0500619_047496 3300053154 Bacteria 1380
156 Ga0500622_0001593 3300053156 Bacteria 17845
157 Ga0500627_0024353 3300053158 Bacteria 2477
158 Ga0501082_0003458 3300060353 Bacteria 13779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031730 Ga0307516_10008414 Ga0307516_100084148 276
2 3300042184 Ga0450908_000019 Ga0450908_000019_23332_24246 281
3 3300030521 Ga0307511_10000259 Ga0307511_100002598 286
4 3300005347 Ga0070668_100337863 Ga0070668_1003378632 288
5 3300005615 Ga0070702_100088388 Ga0070702_1000883882 288
6 3300009094 Ga0111539_10293148 Ga0111539_102931482 288
7 3300009553 Ga0105249_10546445 Ga0105249_105464451 288
8 3300050511 nmdc:mga08y16_525312_c1 nmdc:mga08y16_525312_c1_38_904 288
9 3300031824 Ga0307413_10214381 Ga0307413_102143812 289
10 3300031903 Ga0307407_10135041 Ga0307407_101350411 289
11 3300032002 Ga0307416_100120868 Ga0307416_1001208683 289
12 3300048909 Ga0496106_0316894 Ga0496106_0316894_53_973 289
13 3300046460 Ga0495638_0148650 Ga0495638_0148650_246_1157 292
14 3300005549 Ga0070704_100255167 Ga0070704_1002551671 294
15 3300048927 Ga0496124_0097489 Ga0496124_0097489_1407_2306 294
16 3300005614 Ga0068856_100023499 Ga0068856_1000234994 295
17 3300026078 Ga0207702_10068614 Ga0207702_100686143 295
18 3300048928 Ga0496125_0028028 Ga0496125_0028028_3094_3987 295
19 3300049580 Ga0501046_0334184 Ga0501046_0334184_13_915 295
20 iso_pu_bacteria 2571042365 2572254346 296
21 iso_pu_bacteria 2643221695 2644528231 296
22 iso_pu_bacteria 2751185897 2753765027 296
23 iso_pu_bacteria 2841760612 2841762764 296
24 iso_pu_bacteria 2844104063 2844110228 296
25 iso_pu_bacteria 2851246043 2851251890 296
26 iso_pu_bacteria 8057529695 8057535198 296
27 3300005455 Ga0070663_100427270 Ga0070663_1004272702 297
28 3300006237 Ga0097621_100311431 Ga0097621_1003114312 297
29 3300006358 Ga0068871_100026760 Ga0068871_1000267605 297
30 3300014969 Ga0157376_10089114 Ga0157376_100891142 297
31 3300026041 Ga0207639_10669706 Ga0207639_106697061 297
32 3300026067 Ga0207678_10014027 Ga0207678_100140275 297
33 3300026121 Ga0207683_10269012 Ga0207683_102690122 297
34 3300049589 Ga0501073_0083747 Ga0501073_0083747_775_1668 297
35 3300049590 Ga0501074_0182035 Ga0501074_0182035_205_1098 297
36 3300053139 Ga0500568_0004776 Ga0500568_0004776_2836_3729 297
37 3300003316 rootH1_10009664 rootH1_100096642 298
38 3300005262 Ga0065165_1006200 Ga0065165_10062002 298
39 3300005347 Ga0070668_100319568 Ga0070668_1003195681 298
40 3300005367 Ga0070667_100336830 Ga0070667_1003368302 298
41 3300005548 Ga0070665_100056619 Ga0070665_1000566192 298
42 3300025292 Ga0209676_1008705 Ga0209676_10087052 298
43 3300025304 Ga0209257_1003653 Ga0209257_100365311 298
44 3300025972 Ga0207668_10083064 Ga0207668_100830642 298
45 3300025986 Ga0207658_10281373 Ga0207658_102813732 298
46 3300031852 Ga0307410_10058866 Ga0307410_100588664 298
47 3300035724 Ga0373933_0139246 Ga0373933_0139246_373_1275 298
48 3300046459 Ga0495629_0042595 Ga0495629_0042595_280_1182 298
49 3300049586 Ga0501070_0145575 Ga0501070_0145575_213_1139 298
50 3300060353 Ga0501082_0003458 Ga0501082_0003458_12086_12991 298
51 iso_pu_bacteria 3002998708 3003002717 298
52 3300003214 JGI25165J46597_1000020 JGI25165J46597_1000020123 299
53 3300005328 Ga0070676_10060115 Ga0070676_100601152 299
54 3300005347 Ga0070668_100109541 Ga0070668_1001095412 299
55 3300005355 Ga0070671_100461288 Ga0070671_1004612881 299
56 3300005367 Ga0070667_100113350 Ga0070667_1001133501 299
57 3300005439 Ga0070711_100046395 Ga0070711_1000463951 299
58 3300005458 Ga0070681_10033644 Ga0070681_100336442 299
59 3300005548 Ga0070665_100041081 Ga0070665_1000410812 299
60 3300005548 Ga0070665_100221283 Ga0070665_1002212832 299
61 3300005617 Ga0068859_100002524 Ga0068859_10000252415 299
62 3300005834 Ga0068851_10042037 Ga0068851_100420372 299
63 3300005842 Ga0068858_100034194 Ga0068858_1000341943 299
64 3300005843 Ga0068860_100069902 Ga0068860_1000699023 299
65 3300005844 Ga0068862_100001858 Ga0068862_10000185816 299
66 3300006931 Ga0097620_100002524 Ga0097620_10000252415 299
67 3300009177 Ga0105248_10254515 Ga0105248_102545152 299
68 3300009545 Ga0105237_10016500 Ga0105237_1001650010 299
69 3300010375 Ga0105239_10409043 Ga0105239_104090432 299
70 3300013296 Ga0157374_10188502 Ga0157374_101885022 299
71 3300014969 Ga0157376_10010571 Ga0157376_100105717 299
72 3300025261 Ga0209233_1000047 Ga0209233_1000047210 299
73 3300025912 Ga0207707_10008453 Ga0207707_100084535 299
74 3300025916 Ga0207663_10012720 Ga0207663_100127202 299
75 3300025986 Ga0207658_10066122 Ga0207658_100661223 299
76 3300026035 Ga0207703_10100969 Ga0207703_101009692 299
77 3300026088 Ga0207641_10060622 Ga0207641_100606224 299
78 3300028379 Ga0268266_10163981 Ga0268266_101639812 299
79 3300028380 Ga0268265_10001878 Ga0268265_100018785 299
80 3300028381 Ga0268264_10084590 Ga0268264_100845902 299
81 3300028381 Ga0268264_10381845 Ga0268264_103818452 299
82 3300048911 Ga0496108_0047366 Ga0496108_0047366_1028_1930 299
83 3300048915 Ga0496112_0552234 Ga0496112_0552234_30_932 299
84 3300048916 Ga0496113_0003084 Ga0496113_0003084_8049_8951 299
85 3300049585 Ga0501069_0071348 Ga0501069_0071348_362_1285 299
86 3300049822 Ga0501035_0259344 Ga0501035_0259344_178_1101 299
87 3300005327 Ga0070658_10001768 Ga0070658_1000176814 300
88 3300005327 Ga0070658_10027606 Ga0070658_100276063 300
89 3300005335 Ga0070666_10000007 Ga0070666_10000007252 300
90 3300005335 Ga0070666_10033871 Ga0070666_100338713 300
91 3300005347 Ga0070668_100258082 Ga0070668_1002580822 300
92 3300005355 Ga0070671_100039229 Ga0070671_1000392294 300
93 3300005548 Ga0070665_100161025 Ga0070665_1001610252 300
94 3300005548 Ga0070665_100186439 Ga0070665_1001864392 300
95 3300005614 Ga0068856_100027613 Ga0068856_1000276134 300
96 3300005617 Ga0068859_100005258 Ga0068859_1000052585 300
97 3300005617 Ga0068859_100032277 Ga0068859_1000322774 300
98 3300005719 Ga0068861_100047945 Ga0068861_1000479454 300
99 3300005841 Ga0068863_100022185 Ga0068863_1000221854 300
100 3300005842 Ga0068858_100023654 Ga0068858_1000236544 300
101 3300005843 Ga0068860_100039313 Ga0068860_1000393133 300
102 3300005981 Ga0081538_10046705 Ga0081538_100467052 300
103 3300006931 Ga0097620_100005258 Ga0097620_1000052585 300
104 3300006931 Ga0097620_100032278 Ga0097620_1000322783 300
105 3300009101 Ga0105247_10002114 Ga0105247_1000211412 300
106 3300009177 Ga0105248_10002800 Ga0105248_1000280017 300
107 3300009551 Ga0105238_10000179 Ga0105238_1000017920 300
108 3300009553 Ga0105249_10048088 Ga0105249_100480882 300
109 3300013306 Ga0163162_10021868 Ga0163162_100218682 300
110 3300013306 Ga0163162_10375593 Ga0163162_103755931 300
111 3300014325 Ga0163163_10082875 Ga0163163_100828752 300
112 3300014968 Ga0157379_10061014 Ga0157379_100610143 300
113 3300014968 Ga0157379_10157789 Ga0157379_101577891 300
114 3300025900 Ga0207710_10005363 Ga0207710_100053634 300
115 3300025903 Ga0207680_10000002 Ga0207680_10000002575 300
116 3300025909 Ga0207705_10008875 Ga0207705_100088754 300
117 3300025914 Ga0207671_10074593 Ga0207671_100745933 300
118 3300025924 Ga0207694_10000369 Ga0207694_1000036913 300
119 3300025931 Ga0207644_10012207 Ga0207644_100122074 300
120 3300025941 Ga0207711_10004281 Ga0207711_1000428110 300
121 3300025941 Ga0207711_10235400 Ga0207711_102354003 300
122 3300025961 Ga0207712_10019717 Ga0207712_100197172 300
123 3300025986 Ga0207658_10125055 Ga0207658_101250551 300
124 3300026035 Ga0207703_10025077 Ga0207703_100250774 300
125 3300026088 Ga0207641_10092303 Ga0207641_100923033 300
126 3300028379 Ga0268266_10000004 Ga0268266_10000004573 300
127 3300028381 Ga0268264_10033549 Ga0268264_100335495 300
128 3300028381 Ga0268264_10067503 Ga0268264_100675032 300
129 3300028794 Ga0307515_10014436 Ga0307515_1001443616 300
130 3300030745 Ga0316182_1220337 Ga0316182_12203372 300
131 3300031731 Ga0307405_10309012 Ga0307405_103090122 300
132 3300031731 Ga0307405_10385520 Ga0307405_103855201 300
133 3300032002 Ga0307416_100329234 Ga0307416_1003292341 300
134 3300032004 Ga0307414_10190909 Ga0307414_101909092 300
135 3300032005 Ga0307411_10005661 Ga0307411_100056615 300
136 3300042006 Ga0439432_010298 Ga0439432_010298_2217_3131 300
137 3300042007 Ga0439449_0006389 Ga0439449_0006389_137_1060 300
138 3300044693 Ga0466961_0272311 Ga0466961_0272311_53_967 300
139 3300045049 Ga0466959_0082350 Ga0466959_0082350_1265_2179 300
140 3300046471 Ga0495650_0002264 Ga0495650_0002264_5660_6568 300
141 3300046471 Ga0495650_0063565 Ga0495650_0063565_392_1300 300
142 3300046538 Ga0495609_0044757 Ga0495609_0044757_925_1827 300
143 3300046660 Ga0495625_0001137 Ga0495625_0001137_13529_14431 300
144 3300046810 Ga0495660_0000008 Ga0495660_0000008_99377_100318 300
145 3300048905 Ga0496102_0063488 Ga0496102_0063488_1820_2731 300
146 3300048913 Ga0496110_0186913 Ga0496110_0186913_583_1488 300
147 3300048921 Ga0496118_0020885 Ga0496118_0020885_1597_2508 300
148 3300048924 Ga0496121_0041539 Ga0496121_0041539_380_1291 300
149 3300048929 Ga0496126_0039008 Ga0496126_0039008_3105_4013 300
150 3300053139 Ga0500568_0029675 Ga0500568_0029675_310_1236 300
151 3300053156 Ga0500622_0001593 Ga0500622_0001593_11446_12372 300
152 3300053158 Ga0500627_0024353 Ga0500627_0024353_1460_2431 300
153 iso_pu_bacteria 8055632911 8055637691 300
154 3300002244 JGI24742J22300_10009159 JGI24742J22300_100091592 301
155 3300003215 JGI25153J46596_10000005 JGI25153J46596_10000005144 301
156 3300005331 Ga0070670_100431844 Ga0070670_1004318442 301
157 3300025261 Ga0209233_1007654 Ga0209233_10076543 301
158 3300025297 Ga0209758_1000001 Ga0209758_1000001144 301
159 3300042007 Ga0439449_0017572 Ga0439449_0017572_340_1290 301
160 3300046471 Ga0495650_0001675 Ga0495650_0001675_3076_3981 301
161 3300046506 Ga0495583_0011675 Ga0495583_0011675_1777_2682 301
162 3300046506 Ga0495583_0013987 Ga0495583_0013987_1172_2077 301
163 3300046513 Ga0495616_0016361 Ga0495616_0016361_2392_3297 301
164 3300047443 Ga0495687_001488 Ga0495687_001488_19639_20562 301
165 3300048904 Ga0496101_0008623 Ga0496101_0008623_1751_2713 301
166 3300049673 Ga0501240_006635 Ga0501240_006635_130_1146 301
167 3300053154 Ga0500619_047496 Ga0500619_047496_357_1262 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04199

Cyclase

Putative cyclase

117

273

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4co9-assembly2.cif.gz_A crystal structure of kynurenine formamidase from bacillus anthracis 0.9081 83 299
4cob-assembly1.cif.gz_B crystal structure kynurenine formamidase from pseudomonas aeruginosa 0.9025 84 299
4cog-assembly2.cif.gz_D crystal structure of kynurenine formamidase from burkholderia cenocepacia 0.9013 84 299
3krv-assembly1.cif.gz_B the structure of potential metal-dependent hydrolase with cyclase activity 0.8992 82 298
4co9-assembly2.cif.gz_A crystal structure of kynurenine formamidase from bacillus anthracis 0.8958 83 299
ID Description Score Start End Superfamily
4co9B00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.9145 83 297 3.50.30.50
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.9025 84 299 3.50.30.50
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8992 82 298 3.50.30.50
4co9B00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8938 83 297 3.50.30.50
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8901 84 299 3.50.30.50
ID Description Score Start End GO Terms
AF-A0A3D0UM03-F1-model_v4 Cyclase 0.9952 190 301 GO:0004061
GO:0019441
AF-A0A831X0Y5-F1-model_v4 Cyclase family protein 0.9917 194 299 GO:0004061
GO:0019441
AF-A0A2D7J0L9-F1-model_v4 Cyclase 0.9898 83 299 GO:0004061
GO:0019441
AF-A0A6P2CV36-F1-model_v4 Cyclase 0.9897 84 299 GO:0004061
GO:0019441
AF-A0A150PRI6-F1-model_v4 Cyclase 0.9895 86 275 GO:0004061
GO:0019441

Feature Viewer

pLDDT pTM Quality
91.5 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map