F251069

General Info

Members Datasets Scaffolds Average Seq Length
167 126 164 289

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0011878|Ga0466971_0011878_334_1254
Length 306
Sequence VNPRRYALTHRTRYGYDSDVLVSYGRAHLIPRHGEGQHRLEYAVDTEPAATDYAEHTDFFGNRSTYFVVREPHRELTVTSRSLLDVHRRVDRDALRDVRARSVRERLADGADLDPDVLAARPFLLPSPMIGRTPEVAEFATDLLRPARSLDEVLVDLLERIAGFAYVPGVTTVSTSPVEILARRQGVCQDFAHLGVAALRAVGLAARYVSGYLETRPPPGRPRLTGADASHAWVSVWAPGVGWVDLDPTNAQFIDDSYVVAAVGRDYGDVPPVRGVIFTESTQSTLEVSVDLAPVTPAGVEISAGG

Samples

Sample ID Description Type Environment
1 2643221615 Nocardioides sp. Root224 Isolate Unclassified
2 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
3 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
51 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
52 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
53 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
54 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
55 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
56 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
59 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
63 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
72 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
73 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
74 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
75 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
76 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
77 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
78 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
79 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
80 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
88 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
89 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
113 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
114 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
119 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
121 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
122 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
123 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
124 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
125 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 0
Isolates 1.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.98
Nodule 0
Rhizoplane 0.6
Rhizosphere 86.83
Stem 0
Stem Tuber 0
Unclassified 3.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10110651 3300003320 Bacteria 10349
2 JGI25160J50197_1000964 3300003354 Bacteria 15026
3 JGI25407J50210_10038935 3300003373 Bacteria 1220
4 Ga0070682_100130902 3300005337 Unclassified 1698
5 Ga0070668_100099862 3300005347 Unclassified 2299
6 Ga0070675_100050237 3300005354 Bacteria 3424
7 Ga0068867_100059763 3300005459 Bacteria 2826
8 Ga0070686_100020099 3300005544 Bacteria 3949
9 Ga0068855_100335917 3300005563 Bacteria 1667
10 Ga0068856_100080456 3300005614 Bacteria 3231
11 Ga0068856_100088552 3300005614 Bacteria 3078
12 Ga0068856_100205396 3300005614 Bacteria 1985
13 Ga0068859_100003004 3300005617 Bacteria 17108
14 Ga0068863_100257620 3300005841 Unclassified 1686
15 Ga0081538_10000186 3300005981 Bacteria 68308
16 Ga0075365_10002511 3300006038 Bacteria 9039
17 Ga0075363_100070509 3300006048 Bacteria 1898
18 Ga0075432_10001509 3300006058 Bacteria 7605
19 Ga0075367_10001173 3300006178 Bacteria 10973
20 Ga0097621_100415482 3300006237 Unclassified 1207
21 Ga0068871_100089061 3300006358 Bacteria 2568
22 Ga0075428_100035240 3300006844 Bacteria 5517
23 Ga0075431_100041144 3300006847 Bacteria 4765
24 Ga0075433_10000280 3300006852 Bacteria 30279
25 Ga0075434_100000655 3300006871 Bacteria 26853
26 Ga0075429_100048617 3300006880 Bacteria 3688
27 Ga0097620_100003004 3300006931 Bacteria 17108
28 Ga0075435_100007882 3300007076 Bacteria 7621
29 Ga0105240_10126681 3300009093 Bacteria 3068
30 Ga0105240_10132066 3300009093 Unclassified 2994
31 Ga0111539_10009597 3300009094 Bacteria 12216
32 Ga0114129_10007888 3300009147 Bacteria 15149
33 Ga0105238_10052698 3300009551 Bacteria 4090
34 Ga0105238_10169236 3300009551 Bacteria 2161
35 Ga0157374_10214484 3300013296 Unclassified 1888
36 Ga0157378_10064473 3300013297 Bacteria 3277
37 Ga0157375_10052280 3300013308 Bacteria 4015
38 Ga0157375_10262890 3300013308 Bacteria 1887
39 Ga0157379_10189973 3300014968 Unclassified 1856
40 Ga0157376_10050735 3300014969 Bacteria 3443
41 Ga0163161_10251071 3300017792 Bacteria 1379
42 Ga0207426_1000089 3300025302 Bacteria 281224
43 Ga0207688_10078425 3300025901 Bacteria 1882
44 Ga0207694_10046643 3300025924 Bacteria 3349
45 Ga0207694_10104821 3300025924 Unclassified 2244
46 Ga0207670_10044751 3300025936 Bacteria 2930
47 Ga0207667_10448782 3300025949 Bacteria 1311
48 Ga0207668_10502187 3300025972 Bacteria 1043
49 Ga0207658_10155747 3300025986 Bacteria 1867
50 Ga0207702_10047348 3300026078 Unclassified 3623
51 Ga0207702_10142692 3300026078 Bacteria 2169
52 Ga0207641_10238045 3300026088 Unclassified 1695
53 Ga0207641_10275925 3300026088 Bacteria 1579
54 Ga0207648_10043711 3300026089 Bacteria 3933
55 Ga0209813_10000663 3300027866 Bacteria 7881
56 Ga0207428_10002254 3300027907 Bacteria 19370
57 Ga0265337_1000351 3300028556 Bacteria 24582
58 Ga0265337_1003122 3300028556 Bacteria 7303
59 Ga0265337_1010390 3300028556 Bacteria 3263
60 Ga0265319_1030000 3300028563 Bacteria 1905
61 Ga0265319_1041446 3300028563 Bacteria 1553
62 Ga0265334_10008790 3300028573 Bacteria 4291
63 Ga0265334_10012944 3300028573 Bacteria 3499
64 Ga0265318_10022006 3300028577 Bacteria 2554
65 Ga0265336_10000954 3300028666 Bacteria 14520
66 Ga0265338_10000016 3300028800 Bacteria 347424
67 Ga0265338_10000274 3300028800 Bacteria 93897
68 Ga0265338_10000620 3300028800 Bacteria 61803
69 Ga0265338_10001578 3300028800 Bacteria 36726
70 Ga0265338_10002464 3300028800 Bacteria 27646
71 Ga0265338_10004230 3300028800 Bacteria 19539
72 Ga0265338_10008414 3300028800 Bacteria 12529
73 Ga0265338_10037273 3300028800 Bacteria 4633
74 Ga0265338_10064125 3300028800 Bacteria 3198
75 Ga0265338_10138210 3300028800 Bacteria 1912
76 Ga0265324_10004865 3300029957 Bacteria 5916
77 Ga0265324_10005148 3300029957 Bacteria 5704
78 Ga0265324_10052806 3300029957 Bacteria 1396
79 Ga0265324_10068027 3300029957 Bacteria 1215
80 Ga0265328_10044313 3300031239 Bacteria 1636
81 Ga0265320_10000658 3300031240 Bacteria 26378
82 Ga0265320_10003278 3300031240 Bacteria 10927
83 Ga0265320_10025529 3300031240 Unclassified 3105
84 Ga0265320_10052549 3300031240 Bacteria 1972
85 Ga0265320_10062480 3300031240 Bacteria 1774
86 Ga0265325_10015625 3300031241 Bacteria 4264
87 Ga0265325_10076080 3300031241 Bacteria 1675
88 Ga0265325_10160018 3300031241 Bacteria 1060
89 Ga0265329_10077838 3300031242 Bacteria 1050
90 Ga0265339_10008439 3300031249 Bacteria 6555
91 Ga0265339_10142945 3300031249 Bacteria 1216
92 Ga0265327_10000219 3300031251 Bacteria 116606
93 Ga0265327_10000724 3300031251 Bacteria 51791
94 Ga0265327_10021737 3300031251 Bacteria 3863
95 Ga0265327_10027560 3300031251 Unclassified 3267
96 Ga0265316_10167755 3300031344 Bacteria 1639
97 Ga0265316_10173707 3300031344 Bacteria 1606
98 Ga0265313_10004193 3300031595 Bacteria 11184
99 Ga0265313_10006056 3300031595 Bacteria 8718
100 Ga0265314_10007377 3300031711 Bacteria 9543
101 Ga0265342_10120564 3300031712 Bacteria 1477
102 Ga0307516_10068411 3300031730 Bacteria 3420
103 Ga0307416_100049530 3300032002 Unclassified 3341
104 Ga0373930_0001984 3300034816 Bacteria 3134
105 Ga0373928_0000106 3300035084 Bacteria 15011
106 Ga0373929_0001425 3300035085 Bacteria 4584
107 Ga0373944_0004311 3300035089 Bacteria 3699
108 Ga0373949_0004049 3300035090 Bacteria 3396
109 Ga0373952_0029526 3300035092 Bacteria 1209
110 Ga0373932_0000002 3300035112 Bacteria 711821
111 Ga0373939_0101552 3300035114 Bacteria 988
112 Ga0373945_0024646 3300035116 Bacteria 2086
113 Ga0373924_0057292 3300035410 Bacteria 1625
114 Ga0373931_0000012 3300035691 Bacteria 267735
115 Ga0373935_0116570 3300035692 Bacteria 1779
116 Ga0373927_0006497 3300035695 Bacteria 7964
117 Ga0373927_0057876 3300035695 Bacteria 2506
118 Ga0373947_0007010 3300035725 Bacteria 6529
119 Ga0373937_0496552 3300036401 Bacteria 1159
120 Ga0373925_0000065 3300037068 Bacteria 114215
121 Ga0373925_0025888 3300037068 Bacteria 4289
122 Ga0451843_0021330 3300041509 Bacteria 1200
123 Ga0439448_0005361 3300042005 Bacteria 3656
124 Ga0439463_005706 3300042016 Bacteria 3091
125 Ga0439463_032171 3300042016 Bacteria 1325
126 Ga0466969_0045293 3300044656 Bacteria 2185
127 Ga0466966_0000562 3300044684 Bacteria 23668
128 Ga0466961_0008893 3300044693 Bacteria 6405
129 Ga0466971_0011878 3300044719 Bacteria 3816
130 Ga0466968_0024160 3300044735 Bacteria 2482
131 Ga0466960_0051004 3300044901 Bacteria 1997
132 Ga0466959_0044748 3300045049 Bacteria 3261
133 Ga0466958_0022129 3300045836 Bacteria 3721
134 Ga0466967_0423338 3300045976 Bacteria 1298
135 Ga0495638_0060763 3300046460 Bacteria 2336
136 Ga0495620_0054553 3300046515 Bacteria 1688
137 Ga0495630_0082133 3300046517 Bacteria 2432
138 Ga0495668_0005629 3300046616 Bacteria 8416
139 Ga0495634_0268893 3300046642 Bacteria 1038
140 Ga0495599_0066192 3300046678 Bacteria 2257
141 Ga0495649_0084087 3300046694 Bacteria 1700
142 Ga0495674_0033323 3300047319 Bacteria 4668
143 Ga0496115_0000554 3300048918 Bacteria 28959
144 Ga0501033_0015925 3300049570 Bacteria 5696
145 Ga0501033_0074721 3300049570 Bacteria 2488
146 Ga0501043_0075646 3300049579 Bacteria 2645
147 Ga0501047_0068260 3300049581 Bacteria 3425
148 Ga0501044_0046851 3300049823 Bacteria 4474
149 nmdc:mga03n38_37926_c1 3300050490 Bacteria 2081
150 nmdc:mga0yw44_407_c1 3300050492 Bacteria 15019
151 nmdc:mga06z11_1957_c1 3300050494 Bacteria 7771
152 nmdc:mga09592_148211_c1 3300050508 Unclassified 2024
153 nmdc:mga06r32_23072_c1 3300050510 Bacteria 5756
154 nmdc:mga08y16_22663_c1 3300050511 Bacteria 6631
155 nmdc:mga0n895_71825_c1 3300050512 Bacteria 3433
156 nmdc:mga0rr50_24987_c1 3300050513 Bacteria 4148
157 nmdc:mga0a205_6036_c1 3300050515 Bacteria 10926
158 Ga0500583_0000027 3300053092 Bacteria 109138
159 Ga0500583_0001315 3300053092 Bacteria 7094
160 Ga0500556_0001641 3300053104 Bacteria 8747
161 Ga0500593_000852 3300053117 Bacteria 11353
162 Ga0500579_094626 3300053143 Bacteria 1592
163 Ga0500622_0025817 3300053156 Unclassified 3102
164 Ga0466962_0179512 3300061719 Bacteria 1032

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061719 Ga0466962_0179512 Ga0466962_0179512_231_1022 248
2 3300045976 Ga0466967_0423338 Ga0466967_0423338_23_865 264
3 3300005459 Ga0068867_100059763 Ga0068867_1000597631 265
4 3300005617 Ga0068859_100003004 Ga0068859_1000030045 265
5 3300006931 Ga0097620_100003004 Ga0097620_1000030045 265
6 3300025972 Ga0207668_10502187 Ga0207668_105021871 265
7 3300026088 Ga0207641_10275925 Ga0207641_102759252 265
8 3300053092 Ga0500583_0001315 Ga0500583_0001315_5803_6606 265
9 3300006237 Ga0097621_100415482 Ga0097621_1004154822 267
10 3300006358 Ga0068871_100089061 Ga0068871_1000890612 267
11 3300013297 Ga0157378_10064473 Ga0157378_100644732 267
12 3300013308 Ga0157375_10262890 Ga0157375_102628902 267
13 3300014968 Ga0157379_10189973 Ga0157379_101899732 267
14 3300017792 Ga0163161_10251071 Ga0163161_102510712 267
15 3300006038 Ga0075365_10002511 Ga0075365_100025116 270
16 3300006048 Ga0075363_100070509 Ga0075363_1000705092 270
17 3300006178 Ga0075367_10001173 Ga0075367_100011736 270
18 3300027866 Ga0209813_10000663 Ga0209813_100006636 270
19 3300041509 Ga0451843_0021330 Ga0451843_0021330_174_1052 270
20 3300046515 Ga0495620_0054553 Ga0495620_0054553_439_1335 270
21 3300046694 Ga0495649_0084087 Ga0495649_0084087_689_1585 270
22 3300050490 nmdc:mga03n38_37926_c1 nmdc:mga03n38_37926_c1_970_1866 270
23 3300050492 nmdc:mga0yw44_407_c1 nmdc:mga0yw44_407_c1_4737_5633 270
24 3300050494 nmdc:mga06z11_1957_c1 nmdc:mga06z11_1957_c1_631_1527 270
25 3300044656 Ga0466969_0045293 Ga0466969_0045293_591_1439 276
26 3300044684 Ga0466966_0000562 Ga0466966_0000562_8644_9492 276
27 3300044693 Ga0466961_0008893 Ga0466961_0008893_2923_3771 276
28 3300044735 Ga0466968_0024160 Ga0466968_0024160_107_955 276
29 3300045049 Ga0466959_0044748 Ga0466959_0044748_2085_2933 276
30 3300053104 Ga0500556_0001641 Ga0500556_0001641_1893_2777 276
31 3300013308 Ga0157375_10052280 Ga0157375_100522802 277
32 iso_pu_bacteria 2643221615 2644092740 285
33 iso_pu_bacteria 2643221657 2644322353 285
34 iso_pu_bacteria 2821268502 2821271151 286
35 3300035695 Ga0373927_0006497 Ga0373927_0006497_1056_1925 288
36 3300037068 Ga0373925_0025888 Ga0373925_0025888_1887_2756 288
37 3300044719 Ga0466971_0011878 Ga0466971_0011878_334_1254 288
38 3300044901 Ga0466960_0051004 Ga0466960_0051004_229_1149 288
39 3300045836 Ga0466958_0022129 Ga0466958_0022129_2006_2926 288
40 3300003354 JGI25160J50197_1000964 JGI25160J50197_100096410 289
41 3300003373 JGI25407J50210_10038935 JGI25407J50210_100389351 289
42 3300005347 Ga0070668_100099862 Ga0070668_1000998621 289
43 3300005981 Ga0081538_10000186 Ga0081538_1000018629 289
44 3300006058 Ga0075432_10001509 Ga0075432_100015092 289
45 3300006844 Ga0075428_100035240 Ga0075428_1000352407 289
46 3300006847 Ga0075431_100041144 Ga0075431_1000411442 289
47 3300006852 Ga0075433_10000280 Ga0075433_1000028020 289
48 3300006871 Ga0075434_100000655 Ga0075434_1000006553 289
49 3300006880 Ga0075429_100048617 Ga0075429_1000486174 289
50 3300007076 Ga0075435_100007882 Ga0075435_1000078823 289
51 3300009094 Ga0111539_10009597 Ga0111539_100095973 289
52 3300009147 Ga0114129_10007888 Ga0114129_1000788811 289
53 3300014969 Ga0157376_10050735 Ga0157376_100507352 289
54 3300025302 Ga0207426_1000089 Ga0207426_1000089115 289
55 3300025901 Ga0207688_10078425 Ga0207688_100784252 289
56 3300025986 Ga0207658_10155747 Ga0207658_101557472 289
57 3300026089 Ga0207648_10043711 Ga0207648_100437112 289
58 3300027907 Ga0207428_10002254 Ga0207428_100022548 289
59 3300031251 Ga0265327_10000219 Ga0265327_1000021914 289
60 3300031730 Ga0307516_10068411 Ga0307516_100684112 289
61 3300032002 Ga0307416_100049530 Ga0307416_1000495304 289
62 3300042005 Ga0439448_0005361 Ga0439448_0005361_2581_3456 289
63 3300042016 Ga0439463_005706 Ga0439463_005706_539_1414 289
64 3300042016 Ga0439463_032171 Ga0439463_032171_440_1315 289
65 3300046460 Ga0495638_0060763 Ga0495638_0060763_65_943 289
66 3300046616 Ga0495668_0005629 Ga0495668_0005629_7421_8302 289
67 3300050508 nmdc:mga09592_148211_c1 nmdc:mga09592_148211_c1_328_1206 289
68 3300050510 nmdc:mga06r32_23072_c1 nmdc:mga06r32_23072_c1_1957_2835 289
69 3300050511 nmdc:mga08y16_22663_c1 nmdc:mga08y16_22663_c1_4138_5016 289
70 3300050512 nmdc:mga0n895_71825_c1 nmdc:mga0n895_71825_c1_565_1443 289
71 3300050513 nmdc:mga0rr50_24987_c1 nmdc:mga0rr50_24987_c1_3046_3924 289
72 3300050515 nmdc:mga0a205_6036_c1 nmdc:mga0a205_6036_c1_8706_9584 289
73 3300053092 Ga0500583_0000027 Ga0500583_0000027_72820_73692 289
74 3300053117 Ga0500593_000852 Ga0500593_000852_2248_3138 289
75 3300053143 Ga0500579_094626 Ga0500579_094626_228_1103 289
76 3300053156 Ga0500622_0025817 Ga0500622_0025817_409_1284 289
77 3300003320 rootH2_10110651 rootH2_101106515 290
78 3300005337 Ga0070682_100130902 Ga0070682_1001309021 290
79 3300005354 Ga0070675_100050237 Ga0070675_1000502372 290
80 3300005544 Ga0070686_100020099 Ga0070686_1000200992 290
81 3300005563 Ga0068855_100335917 Ga0068855_1003359172 290
82 3300005614 Ga0068856_100080456 Ga0068856_1000804562 290
83 3300005614 Ga0068856_100088552 Ga0068856_1000885521 290
84 3300005614 Ga0068856_100205396 Ga0068856_1002053962 290
85 3300005841 Ga0068863_100257620 Ga0068863_1002576203 290
86 3300009093 Ga0105240_10126681 Ga0105240_101266812 290
87 3300009093 Ga0105240_10132066 Ga0105240_101320662 290
88 3300009551 Ga0105238_10052698 Ga0105238_100526982 290
89 3300009551 Ga0105238_10169236 Ga0105238_101692362 290
90 3300013296 Ga0157374_10214484 Ga0157374_102144842 290
91 3300025924 Ga0207694_10046643 Ga0207694_100466433 290
92 3300025924 Ga0207694_10104821 Ga0207694_101048212 290
93 3300025936 Ga0207670_10044751 Ga0207670_100447512 290
94 3300025949 Ga0207667_10448782 Ga0207667_104487821 290
95 3300026078 Ga0207702_10047348 Ga0207702_100473482 290
96 3300026078 Ga0207702_10142692 Ga0207702_101426922 290
97 3300026088 Ga0207641_10238045 Ga0207641_102380452 290
98 3300028556 Ga0265337_1000351 Ga0265337_100035111 290
99 3300028556 Ga0265337_1003122 Ga0265337_10031229 290
100 3300028556 Ga0265337_1010390 Ga0265337_10103903 290
101 3300028563 Ga0265319_1030000 Ga0265319_10300002 290
102 3300028563 Ga0265319_1041446 Ga0265319_10414462 290
103 3300028573 Ga0265334_10008790 Ga0265334_100087904 290
104 3300028573 Ga0265334_10012944 Ga0265334_100129442 290
105 3300028577 Ga0265318_10022006 Ga0265318_100220062 290
106 3300028666 Ga0265336_10000954 Ga0265336_1000095413 290
107 3300028800 Ga0265338_10000016 Ga0265338_1000001659 290
108 3300028800 Ga0265338_10000274 Ga0265338_1000027430 290
109 3300028800 Ga0265338_10000620 Ga0265338_100006209 290
110 3300028800 Ga0265338_10001578 Ga0265338_1000157822 290
111 3300028800 Ga0265338_10002464 Ga0265338_1000246410 290
112 3300028800 Ga0265338_10004230 Ga0265338_1000423011 290
113 3300028800 Ga0265338_10008414 Ga0265338_100084143 290
114 3300028800 Ga0265338_10037273 Ga0265338_100372732 290
115 3300028800 Ga0265338_10064125 Ga0265338_100641254 290
116 3300028800 Ga0265338_10138210 Ga0265338_101382102 290
117 3300029957 Ga0265324_10004865 Ga0265324_100048652 290
118 3300029957 Ga0265324_10005148 Ga0265324_100051482 290
119 3300029957 Ga0265324_10052806 Ga0265324_100528062 290
120 3300029957 Ga0265324_10068027 Ga0265324_100680271 290
121 3300031239 Ga0265328_10044313 Ga0265328_100443132 290
122 3300031240 Ga0265320_10000658 Ga0265320_1000065815 290
123 3300031240 Ga0265320_10003278 Ga0265320_100032785 290
124 3300031240 Ga0265320_10025529 Ga0265320_100255292 290
125 3300031240 Ga0265320_10052549 Ga0265320_100525492 290
126 3300031240 Ga0265320_10062480 Ga0265320_100624802 290
127 3300031241 Ga0265325_10015625 Ga0265325_100156253 290
128 3300031241 Ga0265325_10076080 Ga0265325_100760802 290
129 3300031241 Ga0265325_10160018 Ga0265325_101600181 290
130 3300031242 Ga0265329_10077838 Ga0265329_100778381 290
131 3300031249 Ga0265339_10008439 Ga0265339_100084396 290
132 3300031249 Ga0265339_10142945 Ga0265339_101429452 290
133 3300031251 Ga0265327_10000724 Ga0265327_1000072423 290
134 3300031251 Ga0265327_10021737 Ga0265327_100217372 290
135 3300031251 Ga0265327_10027560 Ga0265327_100275602 290
136 3300031344 Ga0265316_10167755 Ga0265316_101677552 290
137 3300031344 Ga0265316_10173707 Ga0265316_101737072 290
138 3300031595 Ga0265313_10004193 Ga0265313_100041932 290
139 3300031595 Ga0265313_10006056 Ga0265313_100060563 290
140 3300031711 Ga0265314_10007377 Ga0265314_100073774 290
141 3300031712 Ga0265342_10120564 Ga0265342_101205642 290
142 3300034816 Ga0373930_0001984 Ga0373930_0001984_535_1410 290
143 3300035084 Ga0373928_0000106 Ga0373928_0000106_6279_7154 290
144 3300035085 Ga0373929_0001425 Ga0373929_0001425_2967_3842 290
145 3300035089 Ga0373944_0004311 Ga0373944_0004311_1217_2092 290
146 3300035090 Ga0373949_0004049 Ga0373949_0004049_578_1453 290
147 3300035092 Ga0373952_0029526 Ga0373952_0029526_196_1071 290
148 3300035112 Ga0373932_0000002 Ga0373932_0000002_260289_261164 290
149 3300035114 Ga0373939_0101552 Ga0373939_0101552_75_950 290
150 3300035116 Ga0373945_0024646 Ga0373945_0024646_26_901 290
151 3300035410 Ga0373924_0057292 Ga0373924_0057292_46_939 290
152 3300035691 Ga0373931_0000012 Ga0373931_0000012_260308_261183 290
153 3300035692 Ga0373935_0116570 Ga0373935_0116570_367_1242 290
154 3300035695 Ga0373927_0057876 Ga0373927_0057876_81_956 290
155 3300035725 Ga0373947_0007010 Ga0373947_0007010_4869_5744 290
156 3300036401 Ga0373937_0496552 Ga0373937_0496552_162_1055 290
157 3300037068 Ga0373925_0000065 Ga0373925_0000065_27249_28124 290
158 3300046517 Ga0495630_0082133 Ga0495630_0082133_434_1327 290
159 3300046642 Ga0495634_0268893 Ga0495634_0268893_122_1015 290
160 3300046678 Ga0495599_0066192 Ga0495599_0066192_111_1004 290
161 3300047319 Ga0495674_0033323 Ga0495674_0033323_2609_3502 290
162 3300048918 Ga0496115_0000554 Ga0496115_0000554_13874_14746 290
163 3300049570 Ga0501033_0015925 Ga0501033_0015925_1191_2063 290
164 3300049570 Ga0501033_0074721 Ga0501033_0074721_647_1522 290
165 3300049579 Ga0501043_0075646 Ga0501043_0075646_335_1210 290
166 3300049581 Ga0501047_0068260 Ga0501047_0068260_625_1500 290
167 3300049823 Ga0501044_0046851 Ga0501044_0046851_1145_2020 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08379

Bact_transglu_N

Bacterial transglutaminase-like N-terminal region

6

85

0.98

PF01841

Transglut_core

Transglutaminase-like superfamily

137

248

0.86

PF04473

DUF553

Transglutaminase-like domain

141

266

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3isr-assembly1.cif.gz_B the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a 0.7972 1 283
3isr-assembly1.cif.gz_B the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a 0.718 1 283
4ktr-assembly4.cif.gz_H crystal structure of 2-o-alpha-glucosylglycerol phosphorylase in complex with isofagomine and glycerol 0.6851 38 82
4b55-assembly1.cif.gz_A crystal structure of the covalent adduct formed between mycobacterium marinum aryalamine n-acetyltransferase and phenyl vinyl ketone a derivative of piperidinols 0.6437 149 244
1w5r-assembly1.cif.gz_B x-ray crystallographic structure of a c70q mycobacterium smegmatis n- arylamine acetyltransferase 0.6331 149 244
ID Description Score Start End Superfamily
af_P9WL93_122_301_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.9313 111 275 3.10.620.30
3isrC01 Alpha Beta;Roll;C8orf32 fold; 0.8591 114 265 3.10.620.30
af_P9WL93_122_301_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8523 111 275 3.10.620.30
af_P71734_77_269_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8023 82 278 3.10.620.30
af_O53920_94_280_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.79 106 262 3.10.620.30
ID Description Score Start End GO Terms
AF-A0A1Y5TG69-F1-model_v4 Protein-glutamine gamma-glutamyltransferase (EC 2.3.2.13) 0.9786 1 290 GO:0003810
AF-A0A4P5Z2Q6-F1-model_v4 Transglutaminase 0.9769 1 290
AF-A0A258K489-F1-model_v4 Transglutaminase 0.9764 1 86
AF-A0A2E7D2J3-F1-model_v4 Transglutaminase 0.9758 2 290
AF-A0A2P5NVX8-F1-model_v4 Transglutaminase 0.9758 1 88

Feature Viewer

pLDDT pTM Quality
92.66 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map