F250742

General Info

Members Datasets Scaffolds Average Seq Length
167 91 334 183

Family's Representative Sequence

Representative Sequence 3300028577|Ga0265318_10189459|Ga0265318_101894592
Length 193
Sequence MTTPVFVFNPSTQMNERLIPVNSKEDILPDYQNTPIGLLLEYHNLDRPFDSYQNAQLLVGMCMDSRKHLHMPDNFAFIIRSGGANLRYSEFKVSYAISVGGVRHIALIGHNNCGMVNLIARKDQFIEGLIATGWDKTQAEDHFFHFAPMHEIGNETDFILSETKRLRLRYPNIKIAPMLYLVENNKLYFIKED

Samples

Sample ID Description Type Environment
1 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
36 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
38 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
39 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
40 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
41 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
42 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
43 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
46 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
47 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
48 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
49 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
52 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
53 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
54 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
58 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
59 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
60 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
74 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
75 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
76 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
81 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
82 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
83 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
84 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
85 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
86 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
87 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
88 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
89 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
90 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
91 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.2
Stem 0
Stem Tuber 0
Unclassified 16.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265318_10189459 3300028577 Unclassified 753
2 Ga0065715_10441873 3300005293 Bacteria 835
3 Ga0070683_100325000 3300005329 Bacteria 1464
4 Ga0070690_100007420 3300005330 Bacteria 6284
5 Ga0070705_100770197 3300005440 Bacteria 763
6 Ga0070706_100104750 3300005467 Unclassified 2631
7 Ga0070707_100323134 3300005468 Bacteria 1499
8 Ga0070707_100731237 3300005468 Bacteria 953
9 Ga0070707_101184654 3300005468 Bacteria 730
10 Ga0070698_100062181 3300005471 Bacteria 3766
11 Ga0070698_100311003 3300005471 Bacteria 1506
12 Ga0070699_100004176 3300005518 Bacteria 12776
13 Ga0070697_100635755 3300005536 Bacteria 939
14 Ga0070695_100064265 3300005545 Unclassified 2387
15 Ga0070695_100112562 3300005545 Bacteria 1849
16 Ga0070695_101047619 3300005545 Bacteria 665
17 Ga0070696_100493762 3300005546 Unclassified 973
18 Ga0070704_100696411 3300005549 Bacteria 901
19 Ga0068857_101386244 3300005577 Bacteria 683
20 Ga0068859_101358288 3300005617 Bacteria 783
21 Ga0068858_100113034 3300005842 Bacteria 2536
22 Ga0068862_100173249 3300005844 Bacteria 1933
23 Ga0081539_10033835 3300005985 Bacteria 3103
24 Ga0075432_10099283 3300006058 Bacteria 1074
25 Ga0075428_100008216 3300006844 Bacteria 11577
26 Ga0075428_100060285 3300006844 Bacteria 4156
27 Ga0075430_100011297 3300006846 Bacteria 7573
28 Ga0075433_10464045 3300006852 Unclassified 1116
29 Ga0075429_100011854 3300006880 Bacteria 7559
30 Ga0075429_100012770 3300006880 Bacteria 7285
31 Ga0075429_100202800 3300006880 Unclassified 1738
32 Ga0075429_100420055 3300006880 Bacteria 1171
33 Ga0097620_101358308 3300006931 Bacteria 783
34 Ga0114129_10099280 3300009147 Bacteria 4030
35 Ga0114129_10463383 3300009147 Unclassified 1661
36 Ga0114129_11277779 3300009147 Unclassified 911
37 Ga0105242_10111894 3300009176 Bacteria 2329
38 Ga0105242_10122104 3300009176 Bacteria 2237
39 Ga0105249_10025935 3300009553 Bacteria 5279
40 Ga0163163_10151482 3300014325 Bacteria 2363
41 Ga0157380_10000043 3300014326 Bacteria 75738
42 Ga0157380_10158228 3300014326 Unclassified 1966
43 Ga0213875_10005117 3300021388 Bacteria 7094
44 Ga0207684_10245965 3300025910 Bacteria 1543
45 Ga0207646_10007485 3300025922 Bacteria 11084
46 Ga0207686_10288948 3300025934 Bacteria 1213
47 Ga0207703_10101072 3300026035 Bacteria 2444
48 Ga0207428_10552113 3300027907 Unclassified 833
49 Ga0268265_10897754 3300028380 Unclassified 870
50 Ga0265337_1000058 3300028556 Bacteria 50152
51 Ga0265326_10000407 3300028558 Bacteria 17275
52 Ga0265326_10030568 3300028558 Bacteria 1534
53 Ga0265319_1000036 3300028563 Bacteria 115781
54 Ga0265319_1001335 3300028563 Bacteria 14877
55 Ga0265334_10002027 3300028573 Bacteria 9587
56 Ga0265334_10028257 3300028573 Bacteria 2255
57 Ga0265318_10001331 3300028577 Bacteria 14799
58 Ga0265323_10000303 3300028653 Bacteria 28462
59 Ga0265322_10000207 3300028654 Bacteria 26051
60 Ga0265336_10000041 3300028666 Bacteria 136990
61 Ga0265338_10000056 3300028800 Bacteria 200914
62 Ga0265338_10000432 3300028800 Bacteria 75203
63 Ga0265338_10001235 3300028800 Bacteria 42204
64 Ga0265324_10000468 3300029957 Bacteria 28382
65 Ga0265324_10001493 3300029957 Bacteria 13263
66 Ga0265324_10024737 3300029957 Unclassified 2131
67 Ga0265324_10138772 3300029957 Unclassified 826
68 Ga0265330_10000737 3300031235 Bacteria 20651
69 Ga0265332_10000291 3300031238 Bacteria 39487
70 Ga0265332_10053309 3300031238 Unclassified 1736
71 Ga0265328_10000524 3300031239 Bacteria 17867
72 Ga0265320_10002040 3300031240 Bacteria 14221
73 Ga0265320_10026138 3300031240 Bacteria 3059
74 Ga0265325_10006194 3300031241 Bacteria 7296
75 Ga0265329_10000331 3300031242 Bacteria 25099
76 Ga0265340_10040241 3300031247 Bacteria 2303
77 Ga0265340_10058560 3300031247 Bacteria 1849
78 Ga0265340_10248350 3300031247 Bacteria 793
79 Ga0265339_10000497 3300031249 Bacteria 30642
80 Ga0265339_10020897 3300031249 Bacteria 3818
81 Ga0265339_10073350 3300031249 Unclassified 1820
82 Ga0265339_10112590 3300031249 Bacteria 1406
83 Ga0265331_10000519 3300031250 Bacteria 35699
84 Ga0265331_10234061 3300031250 Bacteria 825
85 Ga0265316_10005981 3300031344 Bacteria 11711
86 Ga0265316_10010088 3300031344 Bacteria 8631
87 Ga0265316_10120419 3300031344 Bacteria 1982
88 Ga0307408_100563274 3300031548 Bacteria 1007
89 Ga0307408_100739182 3300031548 Unclassified 888
90 Ga0265313_10045498 3300031595 Unclassified 2136
91 Ga0265313_10114278 3300031595 Bacteria 1184
92 Ga0265314_10000782 3300031711 Bacteria 37770
93 Ga0265342_10001519 3300031712 Bacteria 21471
94 Ga0265342_10006511 3300031712 Bacteria 8691
95 Ga0316576_10231096 3300031727 Bacteria 1390
96 Ga0307406_10769150 3300031901 Unclassified 810
97 Ga0307409_100787695 3300031995 Bacteria 957
98 Ga0307409_102029247 3300031995 Unclassified 605
99 Ga0307416_101335966 3300032002 Unclassified 823
100 Ga0316583_10002527 3300032133 Bacteria 6368
101 Ga0316583_10058077 3300032133 Bacteria 1358
102 Ga0316574_0203892 3300035398 Bacteria 1270
103 Ga0373925_0385284 3300037068 Bacteria 1142
104 Ga0436364_1023877 3300037853 Bacteria 7084
105 Ga0400489_79414 3300039093 Bacteria 2534
106 Ga0451577_0013446 3300042876 Bacteria 7658
107 Ga0451577_0017554 3300042876 Bacteria 6610
108 Ga0451577_0022304 3300042876 Bacteria 5781
109 Ga0451577_0050184 3300042876 Bacteria 3725
110 Ga0451577_0188574 3300042876 Bacteria 1860
111 Ga0451577_0504894 3300042876 Bacteria 1098
112 Ga0451577_0669440 3300042876 Bacteria 941
113 Ga0451577_0939208 3300042876 Unclassified 778
114 Ga0453683_0000750 3300044673 Bacteria 32773
115 Ga0453683_0001181 3300044673 Bacteria 23569
116 Ga0453683_0030406 3300044673 Bacteria 3414
117 Ga0453683_0103718 3300044673 Bacteria 1786
118 Ga0453683_0179724 3300044673 Bacteria 1342
119 Ga0453683_0281973 3300044673 Bacteria 1061
120 Ga0453683_0363512 3300044673 Bacteria 930
121 Ga0453683_0406258 3300044673 Unclassified 878
122 Ga0453683_0655145 3300044673 Unclassified 686
123 Ga0453684_0000872 3300044712 Bacteria 101088
124 Ga0453684_0019597 3300044712 Bacteria 10282
125 Ga0453684_0029265 3300044712 Bacteria 7831
126 Ga0453684_0044066 3300044712 Bacteria 5980
127 Ga0453684_0113788 3300044712 Bacteria 3281
128 Ga0453684_0150258 3300044712 Unclassified 2769
129 Ga0453684_0246369 3300044712 Bacteria 2054
130 Ga0453684_0361518 3300044712 Bacteria 1634
131 Ga0453684_0483282 3300044712 Bacteria 1374
132 Ga0453684_0684957 3300044712 Bacteria 1115
133 Ga0453684_0743974 3300044712 Bacteria 1062
134 Ga0453684_0827691 3300044712 Bacteria 996
135 Ga0453684_0908868 3300044712 Bacteria 942
136 Ga0451576_0001951 3300045051 Bacteria 32957
137 Ga0451576_0004683 3300045051 Bacteria 17614
138 Ga0451576_0005347 3300045051 Bacteria 16146
139 Ga0451576_0032489 3300045051 Bacteria 5556
140 Ga0451576_0070887 3300045051 Bacteria 3627
141 Ga0451576_0130894 3300045051 Bacteria 2615
142 Ga0451576_0235680 3300045051 Bacteria 1911
143 Ga0451576_0419847 3300045051 Bacteria 1403
144 Ga0451576_1519992 3300045051 Bacteria 695
145 Ga0495662_0121248 3300046476 Bacteria 1284
146 Ga0495680_0328309 3300047322 Bacteria 1069
147 Ga0495684_0269152 3300047471 Bacteria 1233
148 Ga0501041_0035241 3300049577 Unclassified 3032
149 Ga0501046_0183472 3300049580 Bacteria 1563
150 Ga0501046_0597637 3300049580 Unclassified 783
151 Ga0501047_0133081 3300049581 Bacteria 2367
152 Ga0501048_0071232 3300049582 Bacteria 2454
153 Ga0501072_0197216 3300049588 Bacteria 1605
154 Ga0501076_0031909 3300049592 Bacteria 4111
155 Ga0501079_0071355 3300049741 Bacteria 2683
156 Ga0501081_0516829 3300049743 Bacteria 890
157 Ga0501045_0009020 3300049824 Bacteria 6967
158 nmdc:mga05p37_884182_c1 3300050507 Bacteria 966
159 nmdc:mga09592_18452_c1 3300050508 Bacteria 5723
160 nmdc:mga09592_275974_c1 3300050508 Bacteria 1458
161 nmdc:mga09592_59493_c1 3300050508 Bacteria 3230
162 nmdc:mga0qj67_1020945_c1 3300050509 Unclassified 648
163 nmdc:mga0qj67_96790_c1 3300050509 Bacteria 2376
164 nmdc:mga06r32_136738_c1 3300050510 Bacteria 2425
165 nmdc:mga08y16_615018_c1 3300050511 Bacteria 1094
166 Ga0501084_0145332 3300054114 Bacteria 1997
167 Ga0501082_0025673 3300060353 Bacteria 5077
168 Ga0265318_10189459
169 Ga0065715_10441873
170 Ga0070683_100325000
171 Ga0070690_100007420
172 Ga0070705_100770197
173 Ga0070706_100104750
174 Ga0070707_100323134
175 Ga0070707_100731237
176 Ga0070707_101184654
177 Ga0070698_100062181
178 Ga0070698_100311003
179 Ga0070699_100004176
180 Ga0070697_100635755
181 Ga0070695_100064265
182 Ga0070695_100112562
183 Ga0070695_101047619
184 Ga0070696_100493762
185 Ga0070704_100696411
186 Ga0068857_101386244
187 Ga0068859_101358288
188 Ga0068858_100113034
189 Ga0068862_100173249
190 Ga0081539_10033835
191 Ga0075432_10099283
192 Ga0075428_100008216
193 Ga0075428_100060285
194 Ga0075430_100011297
195 Ga0075433_10464045
196 Ga0075429_100011854
197 Ga0075429_100012770
198 Ga0075429_100202800
199 Ga0075429_100420055
200 Ga0097620_101358308
201 Ga0114129_10099280
202 Ga0114129_10463383
203 Ga0114129_11277779
204 Ga0105242_10111894
205 Ga0105242_10122104
206 Ga0105249_10025935
207 Ga0163163_10151482
208 Ga0157380_10000043
209 Ga0157380_10158228
210 Ga0213875_10005117
211 Ga0207684_10245965
212 Ga0207646_10007485
213 Ga0207686_10288948
214 Ga0207703_10101072
215 Ga0207428_10552113
216 Ga0268265_10897754
217 Ga0265337_1000058
218 Ga0265326_10000407
219 Ga0265326_10030568
220 Ga0265319_1000036
221 Ga0265319_1001335
222 Ga0265334_10002027
223 Ga0265334_10028257
224 Ga0265318_10001331
225 Ga0265323_10000303
226 Ga0265322_10000207
227 Ga0265336_10000041
228 Ga0265338_10000056
229 Ga0265338_10000432
230 Ga0265338_10001235
231 Ga0265324_10000468
232 Ga0265324_10001493
233 Ga0265324_10024737
234 Ga0265324_10138772
235 Ga0265330_10000737
236 Ga0265332_10000291
237 Ga0265332_10053309
238 Ga0265328_10000524
239 Ga0265320_10002040
240 Ga0265320_10026138
241 Ga0265325_10006194
242 Ga0265329_10000331
243 Ga0265340_10040241
244 Ga0265340_10058560
245 Ga0265340_10248350
246 Ga0265339_10000497
247 Ga0265339_10020897
248 Ga0265339_10073350
249 Ga0265339_10112590
250 Ga0265331_10000519
251 Ga0265331_10234061
252 Ga0265316_10005981
253 Ga0265316_10010088
254 Ga0265316_10120419
255 Ga0307408_100563274
256 Ga0307408_100739182
257 Ga0265313_10045498
258 Ga0265313_10114278
259 Ga0265314_10000782
260 Ga0265342_10001519
261 Ga0265342_10006511
262 Ga0316576_10231096
263 Ga0307406_10769150
264 Ga0307409_100787695
265 Ga0307409_102029247
266 Ga0307416_101335966
267 Ga0316583_10002527
268 Ga0316583_10058077
269 Ga0316574_0203892
270 Ga0373925_0385284
271 Ga0436364_1023877
272 Ga0400489_79414
273 Ga0451577_0013446
274 Ga0451577_0017554
275 Ga0451577_0022304
276 Ga0451577_0050184
277 Ga0451577_0188574
278 Ga0451577_0504894
279 Ga0451577_0669440
280 Ga0451577_0939208
281 Ga0453683_0000750
282 Ga0453683_0001181
283 Ga0453683_0030406
284 Ga0453683_0103718
285 Ga0453683_0179724
286 Ga0453683_0281973
287 Ga0453683_0363512
288 Ga0453683_0406258
289 Ga0453683_0655145
290 Ga0453684_0000872
291 Ga0453684_0019597
292 Ga0453684_0029265
293 Ga0453684_0044066
294 Ga0453684_0113788
295 Ga0453684_0150258
296 Ga0453684_0246369
297 Ga0453684_0361518
298 Ga0453684_0483282
299 Ga0453684_0684957
300 Ga0453684_0743974
301 Ga0453684_0827691
302 Ga0453684_0908868
303 Ga0451576_0001951
304 Ga0451576_0004683
305 Ga0451576_0005347
306 Ga0451576_0032489
307 Ga0451576_0070887
308 Ga0451576_0130894
309 Ga0451576_0235680
310 Ga0451576_0419847
311 Ga0451576_1519992
312 Ga0495662_0121248
313 Ga0495680_0328309
314 Ga0495684_0269152
315 Ga0501041_0035241
316 Ga0501046_0183472
317 Ga0501046_0597637
318 Ga0501047_0133081
319 Ga0501048_0071232
320 Ga0501072_0197216
321 Ga0501076_0031909
322 Ga0501079_0071355
323 Ga0501081_0516829
324 Ga0501045_0009020
325 nmdc:mga05p37_884182_c1
326 nmdc:mga09592_18452_c1
327 nmdc:mga09592_275974_c1
328 nmdc:mga09592_59493_c1
329 nmdc:mga0qj67_1020945_c1
330 nmdc:mga0qj67_96790_c1
331 nmdc:mga06r32_136738_c1
332 nmdc:mga08y16_615018_c1
333 Ga0501084_0145332
334 Ga0501082_0025673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

57

146

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g5c-assembly2.cif.gz_D crystal structure of the 'cab' type beta class carbonic anhydrase from methanobacterium thermoautotrophicum 0.7929 41 177
1g5c-assembly3.cif.gz_F crystal structure of the 'cab' type beta class carbonic anhydrase from methanobacterium thermoautotrophicum 0.7912 42 176
1g5c-assembly3.cif.gz_E crystal structure of the 'cab' type beta class carbonic anhydrase from methanobacterium thermoautotrophicum 0.7747 37 176
6jqd-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus 0.7669 36 177
6jqc-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus 0.7412 35 177
ID Description Score Start End Superfamily
3iwgB02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8644 106 136 3.40.630.30
af_O77366_533_906_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8432 142 168 3.60.10.10
af_E7FA20_798_925_3.60.20.30 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase 0.8427 104 136 3.60.20.30
1g5cD00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.7929 41 177 3.40.1050.10
af_Q5A207_1_162_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.7081 32 177 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A523PLD8-F1-model_v4 Carbonic anhydrase 0.9567 4 177 GO:0004089
GO:0008270
AF-A0A524K3Q5-F1-model_v4 Carbonic anhydrase 0.9523 4 176 GO:0004089
GO:0008270
AF-A0A0J8D5Q2-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) 0.9501 2 180 GO:0004089
GO:0008270
AF-A0A2V8X633-F1-model_v4 Carbonic anhydrase 0.9496 1 98
AF-A0A1Y1CLK1-F1-model_v4 Carbonic anhydrase 0.9437 1 177 GO:0004089
GO:0008270

Map