F250293

General Info

Members Datasets Scaffolds Average Seq Length
167 130 334 145

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100261351|Ga0075430_1002613511
Length 166
Sequence VIVAFQKLLNQMFMKRILADKEMTMNKRYTAKATTTIDAPVSKVWQALINPEIIKQYLFNTDVISDWKVGSPITYKGEWEGKPFEDKGEILAIEPEKLLQSTHWSPLSGVPDSPENYHTVTYTLSDGKDGTEVTITQDNNASEEEKSHSEKNWETVLNGMKKLLEA

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
77 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
81 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
82 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
83 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
91 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
92 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
103 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
108 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
119 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
120 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
124 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
125 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
126 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
127 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
128 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
129 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
130 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.61
Metatranscriptomes 0.6
Isolates 4.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.59
Nodule 0
Rhizoplane 5.99
Rhizosphere 85.03
Stem 0
Stem Tuber 0
Unclassified 11.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100261351 3300006846 Bacteria 1434
2 JGI24738J21930_10006602 3300002075 Bacteria 2708
3 Ga0070658_10871473 3300005327 Bacteria 783
4 Ga0070683_100088948 3300005329 Bacteria 2898
5 Ga0070660_101559139 3300005339 Unclassified 562
6 Ga0070692_10005427 3300005345 Bacteria 5438
7 Ga0070674_100158141 3300005356 Bacteria 1717
8 Ga0070673_100090275 3300005364 Bacteria 2503
9 Ga0070709_10366798 3300005434 Bacteria 1067
10 Ga0070713_100242090 3300005436 Bacteria 1643
11 Ga0070701_10021272 3300005438 Bacteria 3093
12 Ga0070706_100006560 3300005467 Bacteria 10979
13 Ga0070698_100017938 3300005471 Bacteria 7453
14 Ga0070679_100039224 3300005530 Bacteria 4707
15 Ga0070684_100286418 3300005535 Bacteria 1510
16 Ga0068853_100034993 3300005539 Unclassified 4265
17 Ga0070672_100008326 3300005543 Bacteria 7086
18 Ga0070686_100012775 3300005544 Bacteria 4792
19 Ga0070696_100232736 3300005546 Unclassified 1387
20 Ga0068852_100007837 3300005616 Bacteria 7818
21 Ga0068851_10185494 3300005834 Bacteria 1154
22 Ga0068862_100726445 3300005844 Bacteria 964
23 Ga0068862_101337863 3300005844 Bacteria 718
24 Ga0075369_10363112 3300006186 Bacteria 680
25 Ga0075428_100137797 3300006844 Bacteria 2653
26 Ga0075428_100816148 3300006844 Unclassified 991
27 Ga0075428_100975748 3300006844 Unclassified 897
28 Ga0075430_100059779 3300006846 Bacteria 3203
29 Ga0075430_100340930 3300006846 Unclassified 1238
30 Ga0075431_100008808 3300006847 Bacteria 10111
31 Ga0075431_100321242 3300006847 Unclassified 1561
32 Ga0075431_100826656 3300006847 Bacteria 899
33 Ga0075429_100005319 3300006880 Bacteria 11080
34 Ga0075429_100023218 3300006880 Bacteria 5380
35 Ga0075429_100363805 3300006880 Bacteria 1266
36 Ga0105240_10239082 3300009093 Bacteria 2106
37 Ga0111539_10166610 3300009094 Bacteria 2576
38 Ga0105245_10028044 3300009098 Bacteria 4962
39 Ga0114129_10020536 3300009147 Bacteria 9394
40 Ga0114129_10033866 3300009147 Bacteria 7215
41 Ga0114129_10437623 3300009147 Bacteria 1717
42 Ga0114129_10496236 3300009147 Unclassified 1595
43 Ga0114129_10871336 3300009147 Unclassified 1143
44 Ga0105248_10143536 3300009177 Bacteria 2694
45 Ga0105237_10940680 3300009545 Bacteria 871
46 Ga0105238_10153900 3300009551 Bacteria 2274
47 Ga0105238_10800909 3300009551 Bacteria 958
48 Ga0105249_10066629 3300009553 Bacteria 3315
49 Ga0105030_103166 3300009987 Unclassified 1423
50 Ga0105239_11889528 3300010375 Unclassified 692
51 Ga0105246_10194111 3300011119 Bacteria 1574
52 Ga0157370_10052482 3300013104 Bacteria 3893
53 Ga0157370_10361435 3300013104 Bacteria 1338
54 Ga0157370_10903894 3300013104 Bacteria 801
55 Ga0157370_11284109 3300013104 Bacteria 660
56 Ga0157369_10451605 3300013105 Bacteria 1331
57 Ga0157374_10881088 3300013296 Bacteria 912
58 Ga0157372_11538170 3300013307 Bacteria 766
59 Ga0163163_10027741 3300014325 Bacteria 5429
60 Ga0157380_10011780 3300014326 Bacteria 6324
61 Ga0157377_10007445 3300014745 Bacteria 5288
62 Ga0224712_10237011 3300022467 Bacteria 839
63 Ga0207697_10017531 3300025315 Bacteria 2942
64 Ga0207643_10010656 3300025908 Bacteria 4955
65 Ga0207705_10707359 3300025909 Bacteria 783
66 Ga0207705_11532103 3300025909 Bacteria 504
67 Ga0207684_10003723 3300025910 Bacteria 14767
68 Ga0207657_10898385 3300025919 Unclassified 682
69 Ga0207652_10041050 3300025921 Bacteria 3931
70 Ga0207652_11490439 3300025921 Unclassified 580
71 Ga0207687_10031079 3300025927 Bacteria 3607
72 Ga0207706_10348607 3300025933 Bacteria 1288
73 Ga0207691_10004490 3300025940 Bacteria 13512
74 Ga0207661_10920188 3300025944 Bacteria 805
75 Ga0207679_10623780 3300025945 Bacteria 973
76 Ga0207667_10518122 3300025949 Bacteria 1208
77 Ga0207668_10068736 3300025972 Bacteria 2520
78 Ga0207658_11091108 3300025986 Bacteria 729
79 Ga0207639_10088085 3300026041 Bacteria 2476
80 Ga0207639_10551749 3300026041 Unclassified 1058
81 Ga0207708_10000938 3300026075 Bacteria 21819
82 Ga0207675_100010046 3300026118 Bacteria 8874
83 Ga0207698_10431268 3300026142 Bacteria 1267
84 Ga0268265_10655051 3300028380 Unclassified 1010
85 Ga0307408_100010420 3300031548 Bacteria 6130
86 Ga0307408_100186083 3300031548 Bacteria 1669
87 Ga0307405_10047167 3300031731 Bacteria 2651
88 Ga0307413_10175663 3300031824 Bacteria 1521
89 Ga0307412_10001725 3300031911 Bacteria 12096
90 Ga0307412_10102455 3300031911 Bacteria 2027
91 Ga0307416_100156705 3300032002 Bacteria 2098
92 Ga0307416_100163529 3300032002 Bacteria 2061
93 Ga0307416_100880810 3300032002 Bacteria 994
94 Ga0307416_101989391 3300032002 Unclassified 684
95 Ga0395899_0036451 3300037312 Bacteria 3689
96 Ga0395899_0050052 3300037312 Bacteria 3103
97 Ga0395898_0030201 3300037466 Bacteria 5424
98 Ga0395898_0119630 3300037466 Bacteria 2523
99 Ga0395905_0699333 3300037471 Bacteria 916
100 Ga0451793_0420670 3300041452 Bacteria 583
101 Ga0451853_3380956 3300041512 Unclassified 539
102 Ga0451577_0140207 3300042876 Bacteria 2172
103 Ga0453683_0044124 3300044673 Bacteria 2797
104 Ga0466965_0011114 3300044683 Bacteria 4213
105 Ga0453684_0007945 3300044712 Bacteria 19234
106 Ga0453684_1243199 3300044712 Bacteria 780
107 Ga0451576_0030987 3300045051 Bacteria 5705
108 Ga0495590_0001102 3300046457 Bacteria 11881
109 Ga0495625_0398829 3300046660 Bacteria 860
110 Ga0495649_0453372 3300046694 Bacteria 640
111 Ga0496100_0954578 3300048903 Bacteria 674
112 Ga0496104_1540147 3300048907 Bacteria 568
113 Ga0496108_0051007 3300048911 Bacteria 3466
114 Ga0496110_0377297 3300048913 Bacteria 1292
115 Ga0496111_0334769 3300048914 Bacteria 1121
116 Ga0496112_0063128 3300048915 Bacteria 3654
117 Ga0496113_0982044 3300048916 Bacteria 666
118 Ga0496113_1501617 3300048916 Bacteria 520
119 Ga0496114_0376902 3300048917 Unclassified 1256
120 Ga0496121_0310210 3300048924 Bacteria 1067
121 Ga0501031_0058112 3300049568 Bacteria 2520
122 Ga0501032_0063571 3300049569 Bacteria 2471
123 Ga0501033_0052182 3300049570 Bacteria 3031
124 Ga0501036_0008058 3300049572 Bacteria 8627
125 Ga0501038_0270593 3300049574 Bacteria 1340
126 Ga0501039_0007937 3300049575 Bacteria 8085
127 Ga0501039_0113999 3300049575 Bacteria 2115
128 Ga0501040_0159441 3300049576 Bacteria 1594
129 Ga0501041_0010660 3300049577 Bacteria 5421
130 Ga0501042_0014730 3300049578 Bacteria 5339
131 Ga0501048_0002662 3300049582 Bacteria 13633
132 Ga0501067_0020724 3300049583 Bacteria 3637
133 Ga0501069_0974630 3300049585 Bacteria 517
134 Ga0501070_0695124 3300049586 Bacteria 805
135 Ga0501074_0013495 3300049590 Bacteria 5940
136 Ga0501076_0028177 3300049592 Bacteria 4360
137 Ga0501227_191105 3300049665 Unclassified 578
138 Ga0501079_0522269 3300049741 Bacteria 933
139 Ga0501035_0020022 3300049822 Bacteria 6147
140 Ga0501045_0007198 3300049824 Bacteria 7720
141 nmdc:mga03n38_475501_c1 3300050490 Bacteria 698
142 nmdc:mga05p37_28706_c1 3300050507 Bacteria 6787
143 nmdc:mga05p37_97681_c1 3300050507 Bacteria 3618
144 nmdc:mga09592_169703_c1 3300050508 Bacteria 1886
145 nmdc:mga09592_30779_c1 3300050508 Bacteria 4468
146 nmdc:mga09592_41364_c1 3300050508 Bacteria 3876
147 nmdc:mga09592_97837_c1 3300050508 Bacteria 2511
148 nmdc:mga0qj67_250890_c1 3300050509 Bacteria 1436
149 nmdc:mga06r32_478387_c1 3300050510 Bacteria 1224
150 nmdc:mga06r32_527160_c1 3300050510 Bacteria 1156
151 nmdc:mga06r32_673234_c1 3300050510 Bacteria 1002
152 nmdc:mga08y16_1072985_c1 3300050511 Bacteria 782
153 nmdc:mga08y16_1425245_c1 3300050511 Bacteria 655
154 nmdc:mga08x19_418653_c1 3300050514 Bacteria 941
155 Ga0500644_0024144 3300053088 Unclassified 1855
156 Ga0500650_0058966 3300053098 Bacteria 1791
157 Ga0500568_0250769 3300053139 Bacteria 645
158 Ga0500616_0000242 3300053153 Bacteria 85918
159 Ga0501084_0177783 3300054114 Bacteria 1796
160 2775658923 2775506735 Bacteria 4556596
161 2808829656 2808606357 Bacteria 4466944
162 2808850838 2808606360 Bacteria 4404006
163 2808876651 2808606366 Bacteria 4415912
164 2808898157 2808606371 Bacteria 4251511
165 2812318642 2811994871 Bacteria 4497550
166 2945916398 2945916053 Bacteria 4555517
167 2974304361 2974302888 Bacteria 4369871
168 Ga0075430_100261351
169 JGI24738J21930_10006602
170 Ga0070658_10871473
171 Ga0070683_100088948
172 Ga0070660_101559139
173 Ga0070692_10005427
174 Ga0070674_100158141
175 Ga0070673_100090275
176 Ga0070709_10366798
177 Ga0070713_100242090
178 Ga0070701_10021272
179 Ga0070706_100006560
180 Ga0070698_100017938
181 Ga0070679_100039224
182 Ga0070684_100286418
183 Ga0068853_100034993
184 Ga0070672_100008326
185 Ga0070686_100012775
186 Ga0070696_100232736
187 Ga0068852_100007837
188 Ga0068851_10185494
189 Ga0068862_100726445
190 Ga0068862_101337863
191 Ga0075369_10363112
192 Ga0075428_100137797
193 Ga0075428_100816148
194 Ga0075428_100975748
195 Ga0075430_100059779
196 Ga0075430_100340930
197 Ga0075431_100008808
198 Ga0075431_100321242
199 Ga0075431_100826656
200 Ga0075429_100005319
201 Ga0075429_100023218
202 Ga0075429_100363805
203 Ga0105240_10239082
204 Ga0111539_10166610
205 Ga0105245_10028044
206 Ga0114129_10020536
207 Ga0114129_10033866
208 Ga0114129_10437623
209 Ga0114129_10496236
210 Ga0114129_10871336
211 Ga0105248_10143536
212 Ga0105237_10940680
213 Ga0105238_10153900
214 Ga0105238_10800909
215 Ga0105249_10066629
216 Ga0105030_103166
217 Ga0105239_11889528
218 Ga0105246_10194111
219 Ga0157370_10052482
220 Ga0157370_10361435
221 Ga0157370_10903894
222 Ga0157370_11284109
223 Ga0157369_10451605
224 Ga0157374_10881088
225 Ga0157372_11538170
226 Ga0163163_10027741
227 Ga0157380_10011780
228 Ga0157377_10007445
229 Ga0224712_10237011
230 Ga0207697_10017531
231 Ga0207643_10010656
232 Ga0207705_10707359
233 Ga0207705_11532103
234 Ga0207684_10003723
235 Ga0207657_10898385
236 Ga0207652_10041050
237 Ga0207652_11490439
238 Ga0207687_10031079
239 Ga0207706_10348607
240 Ga0207691_10004490
241 Ga0207661_10920188
242 Ga0207679_10623780
243 Ga0207667_10518122
244 Ga0207668_10068736
245 Ga0207658_11091108
246 Ga0207639_10088085
247 Ga0207639_10551749
248 Ga0207708_10000938
249 Ga0207675_100010046
250 Ga0207698_10431268
251 Ga0268265_10655051
252 Ga0307408_100010420
253 Ga0307408_100186083
254 Ga0307405_10047167
255 Ga0307413_10175663
256 Ga0307412_10001725
257 Ga0307412_10102455
258 Ga0307416_100156705
259 Ga0307416_100163529
260 Ga0307416_100880810
261 Ga0307416_101989391
262 Ga0395899_0036451
263 Ga0395899_0050052
264 Ga0395898_0030201
265 Ga0395898_0119630
266 Ga0395905_0699333
267 Ga0451793_0420670
268 Ga0451853_3380956
269 Ga0451577_0140207
270 Ga0453683_0044124
271 Ga0466965_0011114
272 Ga0453684_0007945
273 Ga0453684_1243199
274 Ga0451576_0030987
275 Ga0495590_0001102
276 Ga0495625_0398829
277 Ga0495649_0453372
278 Ga0496100_0954578
279 Ga0496104_1540147
280 Ga0496108_0051007
281 Ga0496110_0377297
282 Ga0496111_0334769
283 Ga0496112_0063128
284 Ga0496113_0982044
285 Ga0496113_1501617
286 Ga0496114_0376902
287 Ga0496121_0310210
288 Ga0501031_0058112
289 Ga0501032_0063571
290 Ga0501033_0052182
291 Ga0501036_0008058
292 Ga0501038_0270593
293 Ga0501039_0007937
294 Ga0501039_0113999
295 Ga0501040_0159441
296 Ga0501041_0010660
297 Ga0501042_0014730
298 Ga0501048_0002662
299 Ga0501067_0020724
300 Ga0501069_0974630
301 Ga0501070_0695124
302 Ga0501074_0013495
303 Ga0501076_0028177
304 Ga0501227_191105
305 Ga0501079_0522269
306 Ga0501035_0020022
307 Ga0501045_0007198
308 nmdc:mga03n38_475501_c1
309 nmdc:mga05p37_28706_c1
310 nmdc:mga05p37_97681_c1
311 nmdc:mga09592_169703_c1
312 nmdc:mga09592_30779_c1
313 nmdc:mga09592_41364_c1
314 nmdc:mga09592_97837_c1
315 nmdc:mga0qj67_250890_c1
316 nmdc:mga06r32_478387_c1
317 nmdc:mga06r32_527160_c1
318 nmdc:mga06r32_673234_c1
319 nmdc:mga08y16_1072985_c1
320 nmdc:mga08y16_1425245_c1
321 nmdc:mga08x19_418653_c1
322 Ga0500644_0024144
323 Ga0500650_0058966
324 Ga0500568_0250769
325 Ga0500616_0000242
326 Ga0501084_0177783
327 2775658923
328 2808829656
329 2808850838
330 2808876651
331 2808898157
332 2812318642
333 2945916398
334 2974304361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

38

165

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8912 20 155
2leq-assembly1.cif.gz_A chemical shift assignment and solution structure of chr145 from cytophaga hutchinsonii, northeast structural genomics consortium target chr145 0.8794 19 156
2luz-assembly1.cif.gz_A solution nmr structure of calu16 from micromonospora echinospora, northeast structural genomics consortium (nesg) target mir12 0.8418 18 157
2leq-assembly1.cif.gz_A chemical shift assignment and solution structure of chr145 from cytophaga hutchinsonii, northeast structural genomics consortium target chr145 0.8303 19 156
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.821 20 155
ID Description Score Start End Superfamily
2leqA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8794 19 156 3.30.530.20
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8418 18 157 3.30.530.20
2leqA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8303 19 156 3.30.530.20
af_Q8N9S3_197_326_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8236 19 155 3.30.530.20
af_Q9V9Q4_218_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8119 19 156 3.30.530.20
ID Description Score Start End GO Terms
AF-C6W496-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.9918 19 156
AF-A0A839NK21-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9879 14 155
AF-A0A552V0D2-F1-model_v4 SRPBCC domain-containing protein 0.9837 17 157
AF-A0A6M1ZBP9-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9824 19 157
AF-A0A2S5A5K5-F1-model_v4 ATPase 0.9821 20 157

Map