F250044

General Info

Members Datasets Scaffolds Average Seq Length
167 123 166 201

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100028790|Ga0070706_1000287903
Length 222
Sequence LRLGLIGCLGALVLVLIIVGIWFIGVRNHLVTLDQAVQAQWAQVENDYQRRYDLIPNLVRTVQGAANFEKSTLEAVVNARSRVGQVQAPAAAGGAPGSQSDLPNNPQAMAQFEAAQAGLSNALSRLLVVVERYPELKSNQNFLELQSQLEGTENRIAVERRRYNEVAQQFNSSVLKFPANIVANMFGFKPKAYFRGVPGSNQAPEVNFQPFGQQPAPATGTR

Samples

Sample ID Description Type Environment
1 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
80 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
81 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
82 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
83 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
84 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
92 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
95 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
122 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
123 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 1.8
Rhizosphere 91.62
Stem 0
Stem Tuber 0
Unclassified 5.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1000427 3300002155 Bacteria 4198
2 Ga0065715_10298620 3300005293 Bacteria 1046
3 Ga0065707_10446500 3300005295 Bacteria 805
4 Ga0070683_100000054 3300005329 Bacteria 87927
5 Ga0070683_100250310 3300005329 Unclassified 1685
6 Ga0070670_100000041 3300005331 Bacteria 147849
7 Ga0070670_100079763 3300005331 Unclassified 2813
8 Ga0070677_10120797 3300005333 Bacteria 1183
9 Ga0068869_100313066 3300005334 Bacteria 1271
10 Ga0068869_100470397 3300005334 Bacteria 1045
11 Ga0068868_100002788 3300005338 Bacteria 12101
12 Ga0070661_100001541 3300005344 Bacteria 16033
13 Ga0070675_100000009 3300005354 Bacteria 245759
14 Ga0070675_100789048 3300005354 Bacteria 868
15 Ga0070671_100097394 3300005355 Bacteria 2467
16 Ga0070674_100168867 3300005356 Unclassified 1666
17 Ga0070674_100431058 3300005356 Bacteria 1084
18 Ga0070673_100403114 3300005364 Bacteria 1223
19 Ga0070659_100213125 3300005366 Bacteria 1592
20 Ga0070667_100355627 3300005367 Bacteria 1327
21 Ga0070713_100033701 3300005436 Bacteria 4106
22 Ga0070701_10067027 3300005438 Bacteria 1909
23 Ga0070708_100522017 3300005445 Bacteria 1120
24 Ga0070678_100014959 3300005456 Bacteria 4915
25 Ga0070685_10023631 3300005466 Bacteria 3368
26 Ga0070706_100028790 3300005467 Bacteria 5116
27 Ga0070706_100103482 3300005467 Bacteria 2647
28 Ga0070707_100193782 3300005468 Bacteria 1981
29 Ga0070707_100537496 3300005468 Bacteria 1131
30 Ga0070698_100925493 3300005471 Bacteria 818
31 Ga0070699_100029596 3300005518 Bacteria 4722
32 Ga0070699_100055883 3300005518 Bacteria 3417
33 Ga0070684_100002141 3300005535 Bacteria 14568
34 Ga0070697_100102166 3300005536 Bacteria 2382
35 Ga0070672_100000941 3300005543 Bacteria 17500
36 Ga0070686_100075652 3300005544 Bacteria 2215
37 Ga0070704_100119097 3300005549 Bacteria 2024
38 Ga0068857_100071149 3300005577 Bacteria 3099
39 Ga0068854_100005460 3300005578 Bacteria 8029
40 Ga0070702_100075799 3300005615 Bacteria 2000
41 Ga0068851_10109516 3300005834 Bacteria 1473
42 Ga0070717_10001923 3300006028 Bacteria 14507
43 Ga0070716_100109970 3300006173 Bacteria 1706
44 Ga0070716_100144920 3300006173 Bacteria 1520
45 Ga0075428_100000759 3300006844 Bacteria 33540
46 Ga0075431_100000730 3300006847 Bacteria 28390
47 Ga0075431_100185372 3300006847 Bacteria 2134
48 Ga0075434_100139330 3300006871 Bacteria 2445
49 Ga0075429_100301002 3300006880 Bacteria 1404
50 Ga0075429_100393599 3300006880 Bacteria 1213
51 Ga0075436_100000155 3300006914 Bacteria 42540
52 Ga0075436_100192829 3300006914 Bacteria 1442
53 Ga0075435_100026180 3300007076 Bacteria 4548
54 Ga0075435_100047479 3300007076 Bacteria 3448
55 Ga0075435_100276829 3300007076 Bacteria 1432
56 Ga0105244_10024013 3300009036 Bacteria 3333
57 Ga0105240_10088357 3300009093 Bacteria 3792
58 Ga0111539_10000129 3300009094 Bacteria 85802
59 Ga0105245_10000904 3300009098 Bacteria 26985
60 Ga0105245_10003042 3300009098 Bacteria 15027
61 Ga0105245_10044473 3300009098 Bacteria 3963
62 Ga0114129_10044230 3300009147 Bacteria 6264
63 Ga0105242_10056921 3300009176 Bacteria 3200
64 Ga0105242_10730561 3300009176 Unclassified 972
65 Ga0157369_10006581 3300013105 Bacteria 13433
66 Ga0157374_10059167 3300013296 Bacteria 3582
67 Ga0157378_10057315 3300013297 Bacteria 3472
68 Ga0163162_10020563 3300013306 Bacteria 6485
69 Ga0157372_10447213 3300013307 Bacteria 1506
70 Ga0157372_11981025 3300013307 Bacteria 669
71 Ga0157375_10000035 3300013308 Bacteria 179166
72 Ga0157375_10000303 3300013308 Bacteria 44672
73 Ga0157376_10000049 3300014969 Bacteria 104672
74 Ga0157376_11080972 3300014969 Bacteria 827
75 Ga0213873_10000002 3300021358 Bacteria 1164195
76 Ga0213876_10000010 3300021384 Bacteria 492549
77 Ga0213876_10000012 3300021384 Bacteria 396530
78 Ga0213876_10026831 3300021384 Bacteria 3039
79 Ga0213876_10245100 3300021384 Bacteria 952
80 Ga0207655_1044759 3300025728 Bacteria 1856
81 Ga0207688_10102808 3300025901 Bacteria 1652
82 Ga0207643_10036029 3300025908 Unclassified 2775
83 Ga0207684_10022559 3300025910 Bacteria 5374
84 Ga0207649_10000107 3300025920 Bacteria 69186
85 Ga0207646_10084214 3300025922 Bacteria 2845
86 Ga0207650_10000088 3300025925 Bacteria 123236
87 Ga0207650_10122656 3300025925 Bacteria 2025
88 Ga0207659_10000007 3300025926 Bacteria 322984
89 Ga0207659_10997774 3300025926 Bacteria 720
90 Ga0207687_10000157 3300025927 Bacteria 45617
91 Ga0207687_10001520 3300025927 Bacteria 15891
92 Ga0207700_10039631 3300025928 Bacteria 3432
93 Ga0207644_10054440 3300025931 Bacteria 2882
94 Ga0207686_10062317 3300025934 Bacteria 2368
95 Ga0207665_10142247 3300025939 Bacteria 1712
96 Ga0207665_10177624 3300025939 Bacteria 1541
97 Ga0207665_10527024 3300025939 Unclassified 915
98 Ga0207691_10002608 3300025940 Bacteria 17602
99 Ga0207661_10000001 3300025944 Bacteria 937688
100 Ga0207661_10218405 3300025944 Unclassified 1684
101 Ga0207640_10005065 3300025981 Bacteria 7171
102 Ga0207677_10000089 3300026023 Bacteria 76102
103 Ga0207639_10000003 3300026041 Bacteria 806887
104 Ga0207674_10087292 3300026116 Bacteria 3113
105 Ga0207683_10045531 3300026121 Bacteria 3837
106 Ga0207683_10428385 3300026121 Bacteria 1219
107 Ga0207428_10000189 3300027907 Bacteria 85810
108 Ga0265337_1005076 3300028556 Bacteria 5313
109 Ga0265334_10172123 3300028573 Bacteria 758
110 Ga0316177_1035139 3300030731 Bacteria 21564
111 Ga0316176_1162505 3300030732 Bacteria 1387
112 Ga0316183_1006105 3300030742 Bacteria 90612
113 Ga0316181_1167506 3300030744 Bacteria 16152
114 Ga0265332_10040912 3300031238 Bacteria 2006
115 Ga0265320_10007801 3300031240 Bacteria 6611
116 Ga0265316_10019410 3300031344 Bacteria 5817
117 Ga0307408_100202848 3300031548 Bacteria 1606
118 Ga0307408_100206244 3300031548 Unclassified 1594
119 Ga0265314_10019969 3300031711 Bacteria 5180
120 Ga0316576_10118012 3300031727 Bacteria 1991
121 Ga0316578_10281665 3300031728 Bacteria 995
122 Ga0316577_10037461 3300031733 Bacteria 2712
123 Ga0307412_10000490 3300031911 Bacteria 23654
124 Ga0316583_10004353 3300032133 Bacteria 5051
125 Ga0316583_10014301 3300032133 Bacteria 2863
126 Ga0373932_0000223 3300035112 Bacteria 16939
127 Ga0373943_0290450 3300035170 Bacteria 926
128 Ga0373955_0201453 3300035172 Bacteria 1185
129 Ga0373937_0327466 3300036401 Bacteria 1450
130 Ga0316582_0411856 3300036647 Bacteria 931
131 Ga0316582_0468543 3300036647 Bacteria 868
132 Ga0316584_0197924 3300036712 Bacteria 1484
133 Ga0436365_0203832 3300039437 Bacteria 1773
134 Ga0436365_0597955 3300039437 Bacteria 8681
135 Ga0436365_0800228 3300039437 Bacteria 36005
136 Ga0436365_1718738 3300039437 Bacteria 73809
137 Ga0436362_0768347 3300039453 Bacteria 63778
138 Ga0451839_0506714 3300041496 Bacteria 1390
139 Ga0451577_0137877 3300042876 Bacteria 2191
140 Ga0453683_0003071 3300044673 Bacteria 12498
141 Ga0453683_0076341 3300044673 Bacteria 2098
142 Ga0453683_0119697 3300044673 Bacteria 1657
143 Ga0453684_0000054 3300044712 Bacteria 543775
144 Ga0453684_0006483 3300044712 Bacteria 22199
145 Ga0495620_0000891 3300046515 Bacteria 18314
146 Ga0496102_0396731 3300048905 Bacteria 1297
147 Ga0496108_0361270 3300048911 Bacteria 1267
148 Ga0496109_0078655 3300048912 Bacteria 3037
149 Ga0501033_0001047 3300049570 Bacteria 25220
150 Ga0501038_0046971 3300049574 Bacteria 3741
151 Ga0501067_0013539 3300049583 Bacteria 4518
152 Ga0501073_0003561 3300049589 Bacteria 11703
153 Ga0501080_0008792 3300049742 Bacteria 9178
154 nmdc:mga05p37_296653_c1 3300050507 Bacteria 1922
155 nmdc:mga09592_115925_c1 3300050508 Bacteria 2299
156 nmdc:mga09592_376165_c1 3300050508 Bacteria 1228
157 nmdc:mga06r32_1777_c1 3300050510 Bacteria 19380
158 nmdc:mga06r32_286104_c1 3300050510 Bacteria 1635
159 nmdc:mga08y16_28_c1 3300050511 Bacteria 201429
160 nmdc:mga0rr50_21190_c1 3300050513 Bacteria 4432
161 nmdc:mga0rr50_231218_c1 3300050513 Bacteria 1530
162 nmdc:mga0rr50_53_c1 3300050513 Bacteria 63727
163 nmdc:mga08x19_2211_c1 3300050514 Bacteria 11889
164 nmdc:mga08x19_458_c1 3300050514 Bacteria 27730
165 Ga0495655_0000519 3300053083 Bacteria 6332
166 Ga0500645_017743 3300053730 Bacteria 2227

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100079763 Ga0070670_1000797633 153
2 3300013308 Ga0157375_10000303 Ga0157375_1000030343 154
3 3300005329 Ga0070683_100000054 Ga0070683_10000005441 158
4 3300005535 Ga0070684_100002141 Ga0070684_1000021413 158
5 3300013307 Ga0157372_10447213 Ga0157372_104472132 158
6 3300021384 Ga0213876_10000012 Ga0213876_10000012237 158
7 3300025944 Ga0207661_10000001 Ga0207661_10000001105 158
8 3300035112 Ga0373932_0000223 Ga0373932_0000223_6592_7275 158
9 3300039437 Ga0436365_0800228 Ga0436365_0800228_30749_31408 158
10 3300025925 Ga0207650_10122656 Ga0207650_101226563 159
11 3300021384 Ga0213876_10245100 Ga0213876_102451002 160
12 3300039437 Ga0436365_0203832 Ga0436365_0203832_467_1138 160
13 3300009098 Ga0105245_10003042 Ga0105245_100030426 161
14 3300025927 Ga0207687_10001520 Ga0207687_100015206 161
15 3300005577 Ga0068857_100071149 Ga0068857_1000711492 163
16 3300026116 Ga0207674_10087292 Ga0207674_100872922 163
17 3300026121 Ga0207683_10428385 Ga0207683_104283852 164
18 3300041496 Ga0451839_0506714 Ga0451839_0506714_52_711 165
19 3300005438 Ga0070701_10067027 Ga0070701_100670272 166
20 3300031548 Ga0307408_100206244 Ga0307408_1002062443 166
21 3300031911 Ga0307412_10000490 Ga0307412_1000049022 166
22 3300046515 Ga0495620_0000891 Ga0495620_0000891_3774_4394 166
23 3300005329 Ga0070683_100250310 Ga0070683_1002503102 168
24 3300025944 Ga0207661_10218405 Ga0207661_102184052 168
25 3300021358 Ga0213873_10000002 Ga0213873_100000021015 169
26 3300021384 Ga0213876_10000010 Ga0213876_1000001033 169
27 3300039437 Ga0436365_1718738 Ga0436365_1718738_24510_25145 169
28 3300039453 Ga0436362_0768347 Ga0436362_0768347_14479_15114 169
29 3300032133 Ga0316583_10004353 Ga0316583_100043532 171
30 3300036647 Ga0316582_0411856 Ga0316582_0411856_41_652 171
31 3300049570 Ga0501033_0001047 Ga0501033_0001047_20860_21489 171
32 3300049574 Ga0501038_0046971 Ga0501038_0046971_223_852 171
33 3300005334 Ga0068869_100313066 Ga0068869_1003130662 173
34 3300025939 Ga0207665_10142247 Ga0207665_101422471 173
35 3300025901 Ga0207688_10102808 Ga0207688_101028082 175
36 3300031344 Ga0265316_10019410 Ga0265316_100194105 177
37 3300044712 Ga0453684_0000054 Ga0453684_0000054_514278_514841 177
38 3300044712 Ga0453684_0006483 Ga0453684_0006483_8477_9040 177
39 3300009036 Ga0105244_10024013 Ga0105244_100240133 178
40 iso_pu_bacteria 2842903701 2842907306 178
41 3300005293 Ga0065715_10298620 Ga0065715_102986202 179
42 3300030731 Ga0316177_1035139 Ga0316177_103513910 180
43 3300030732 Ga0316176_1162505 Ga0316176_11625051 180
44 3300030742 Ga0316183_1006105 Ga0316183_100610579 180
45 3300030744 Ga0316181_1167506 Ga0316181_11675066 180
46 3300014969 Ga0157376_11080972 Ga0157376_110809722 181
47 3300031548 Ga0307408_100202848 Ga0307408_1002028483 181
48 3300005331 Ga0070670_100000041 Ga0070670_100000041108 183
49 3300005338 Ga0068868_100002788 Ga0068868_10000278813 183
50 3300005578 Ga0068854_100005460 Ga0068854_1000054608 183
51 3300013105 Ga0157369_10006581 Ga0157369_100065813 183
52 3300014969 Ga0157376_10000049 Ga0157376_1000004977 183
53 3300025925 Ga0207650_10000088 Ga0207650_1000008829 183
54 3300025981 Ga0207640_10005065 Ga0207640_100050653 183
55 3300026023 Ga0207677_10000089 Ga0207677_1000008936 183
56 3300005367 Ga0070667_100355627 Ga0070667_1003556272 184
57 3300005468 Ga0070707_100537496 Ga0070707_1005374962 184
58 3300005549 Ga0070704_100119097 Ga0070704_1001190972 184
59 3300009098 Ga0105245_10000904 Ga0105245_1000090414 184
60 3300013306 Ga0163162_10020563 Ga0163162_100205636 184
61 3300025927 Ga0207687_10000157 Ga0207687_1000015716 184
62 3300025939 Ga0207665_10527024 Ga0207665_105270242 184
63 3300036401 Ga0373937_0327466 Ga0373937_0327466_804_1397 184
64 3300048911 Ga0496108_0361270 Ga0496108_0361270_70_657 184
65 3300048912 Ga0496109_0078655 Ga0496109_0078655_153_740 184
66 3300049583 Ga0501067_0013539 Ga0501067_0013539_3055_3663 184
67 3300005354 Ga0070675_100000009 Ga0070675_100000009127 185
68 3300005355 Ga0070671_100097394 Ga0070671_1000973943 185
69 3300013307 Ga0157372_11981025 Ga0157372_119810251 185
70 3300025728 Ga0207655_1044759 Ga0207655_10447592 185
71 3300025926 Ga0207659_10000007 Ga0207659_10000007129 185
72 3300025931 Ga0207644_10054440 Ga0207644_100544402 185
73 3300031727 Ga0316576_10118012 Ga0316576_101180123 185
74 3300031728 Ga0316578_10281665 Ga0316578_102816652 185
75 3300031733 Ga0316577_10037461 Ga0316577_100374613 185
76 3300032133 Ga0316583_10014301 Ga0316583_100143013 185
77 3300036647 Ga0316582_0468543 Ga0316582_0468543_168_758 185
78 3300036712 Ga0316584_0197924 Ga0316584_0197924_523_1113 185
79 3300005334 Ga0068869_100470397 Ga0068869_1004703972 186
80 3300009176 Ga0105242_10730561 Ga0105242_107305612 186
81 3300028556 Ga0265337_1005076 Ga0265337_10050765 186
82 3300028573 Ga0265334_10172123 Ga0265334_101721232 186
83 3300031238 Ga0265332_10040912 Ga0265332_100409122 186
84 3300031240 Ga0265320_10007801 Ga0265320_100078015 186
85 3300031711 Ga0265314_10019969 Ga0265314_100199695 186
86 3300042876 Ga0451577_0137877 Ga0451577_0137877_662_1267 186
87 3300044673 Ga0453683_0003071 Ga0453683_0003071_518_1123 186
88 3300044673 Ga0453683_0076341 Ga0453683_0076341_524_1129 186
89 3300005354 Ga0070675_100789048 Ga0070675_1007890481 187
90 3300009098 Ga0105245_10044473 Ga0105245_100444733 187
91 3300025926 Ga0207659_10997774 Ga0207659_109977741 187
92 3300035172 Ga0373955_0201453 Ga0373955_0201453_73_678 188
93 3300006847 Ga0075431_100185372 Ga0075431_1001853722 189
94 3300007076 Ga0075435_100026180 Ga0075435_1000261801 189
95 3300050510 nmdc:mga06r32_286104_c1 nmdc:mga06r32_286104_c1_643_1278 189
96 3300050513 nmdc:mga0rr50_53_c1 nmdc:mga0rr50_53_c1_49845_50483 189
97 3300050514 nmdc:mga08x19_2211_c1 nmdc:mga08x19_2211_c1_3167_3805 189
98 3300053083 Ga0495655_0000519 Ga0495655_0000519_2299_2982 189
99 3300005295 Ga0065707_10446500 Ga0065707_104465001 190
100 3300005344 Ga0070661_100001541 Ga0070661_1000015411 190
101 3300005366 Ga0070659_100213125 Ga0070659_1002131252 190
102 3300005436 Ga0070713_100033701 Ga0070713_1000337013 190
103 3300005445 Ga0070708_100522017 Ga0070708_1005220171 190
104 3300005467 Ga0070706_100103482 Ga0070706_1001034824 190
105 3300005468 Ga0070707_100193782 Ga0070707_1001937823 190
106 3300005471 Ga0070698_100925493 Ga0070698_1009254931 190
107 3300005518 Ga0070699_100029596 Ga0070699_1000295965 190
108 3300005536 Ga0070697_100102166 Ga0070697_1001021662 190
109 3300006028 Ga0070717_10001923 Ga0070717_100019233 190
110 3300009176 Ga0105242_10056921 Ga0105242_100569213 190
111 3300025908 Ga0207643_10036029 Ga0207643_100360293 190
112 3300025910 Ga0207684_10022559 Ga0207684_100225598 190
113 3300025920 Ga0207649_10000107 Ga0207649_1000010742 190
114 3300025922 Ga0207646_10084214 Ga0207646_100842143 190
115 3300025928 Ga0207700_10039631 Ga0207700_100396313 190
116 3300025934 Ga0207686_10062317 Ga0207686_100623172 190
117 3300053730 Ga0500645_017743 Ga0500645_017743_1322_1948 190
118 3300005356 Ga0070674_100168867 Ga0070674_1001688671 191
119 3300005544 Ga0070686_100075652 Ga0070686_1000756522 191
120 3300006844 Ga0075428_100000759 Ga0075428_1000007593 191
121 3300006914 Ga0075436_100192829 Ga0075436_1001928292 191
122 3300035170 Ga0373943_0290450 Ga0373943_0290450_114_752 191
123 3300044673 Ga0453683_0119697 Ga0453683_0119697_584_1267 191
124 3300049589 Ga0501073_0003561 Ga0501073_0003561_1625_2257 191
125 3300049742 Ga0501080_0008792 Ga0501080_0008792_1810_2442 191
126 3300006871 Ga0075434_100139330 Ga0075434_1001393302 192
127 3300006914 Ga0075436_100000155 Ga0075436_10000015512 192
128 3300007076 Ga0075435_100276829 Ga0075435_1002768292 192
129 3300009094 Ga0111539_10000129 Ga0111539_1000012979 192
130 3300027907 Ga0207428_10000189 Ga0207428_1000018979 192
131 3300050511 nmdc:mga08y16_28_c1 nmdc:mga08y16_28_c1_80823_81479 192
132 3300050513 nmdc:mga0rr50_231218_c1 nmdc:mga0rr50_231218_c1_542_1168 192
133 3300050514 nmdc:mga08x19_458_c1 nmdc:mga08x19_458_c1_26154_26780 192
134 3300005333 Ga0070677_10120797 Ga0070677_101207972 193
135 3300005543 Ga0070672_100000941 Ga0070672_1000009419 193
136 3300005615 Ga0070702_100075799 Ga0070702_1000757992 193
137 3300005834 Ga0068851_10109516 Ga0068851_101095163 193
138 3300006173 Ga0070716_100144920 Ga0070716_1001449203 193
139 3300006847 Ga0075431_100000730 Ga0075431_1000007304 193
140 3300006880 Ga0075429_100393599 Ga0075429_1003935992 193
141 3300009093 Ga0105240_10088357 Ga0105240_100883573 193
142 3300009147 Ga0114129_10044230 Ga0114129_100442306 193
143 3300013297 Ga0157378_10057315 Ga0157378_100573154 193
144 3300013308 Ga0157375_10000035 Ga0157375_1000003538 193
145 3300021384 Ga0213876_10026831 Ga0213876_100268313 193
146 3300025939 Ga0207665_10177624 Ga0207665_101776242 193
147 3300025940 Ga0207691_10002608 Ga0207691_1000260813 193
148 3300026041 Ga0207639_10000003 Ga0207639_10000003106 193
149 3300039437 Ga0436365_0597955 Ga0436365_0597955_1228_1890 193
150 3300050507 nmdc:mga05p37_296653_c1 nmdc:mga05p37_296653_c1_1027_1698 193
151 3300050508 nmdc:mga09592_376165_c1 nmdc:mga09592_376165_c1_310_963 193
152 3300050510 nmdc:mga06r32_1777_c1 nmdc:mga06r32_1777_c1_14693_15346 193
153 3300005466 Ga0070685_10023631 Ga0070685_100236313 194
154 3300006173 Ga0070716_100109970 Ga0070716_1001099702 194
155 3300006880 Ga0075429_100301002 Ga0075429_1003010022 194
156 3300007076 Ga0075435_100047479 Ga0075435_1000474794 194
157 3300050508 nmdc:mga09592_115925_c1 nmdc:mga09592_115925_c1_465_1118 194
158 3300050513 nmdc:mga0rr50_21190_c1 nmdc:mga0rr50_21190_c1_1500_2168 194
159 3300005467 Ga0070706_100028790 Ga0070706_1000287903 195
160 3300005518 Ga0070699_100055883 Ga0070699_1000558833 195
161 3300048905 Ga0496102_0396731 Ga0496102_0396731_573_1244 195
162 3300002155 JGI24033J26618_1000427 JGI24033J26618_10004271 196
163 3300005356 Ga0070674_100431058 Ga0070674_1004310582 196
164 3300005364 Ga0070673_100403114 Ga0070673_1004031141 196
165 3300005456 Ga0070678_100014959 Ga0070678_1000149591 196
166 3300013296 Ga0157374_10059167 Ga0157374_100591674 196
167 3300026121 Ga0207683_10045531 Ga0207683_100455315 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04011

LemA

LemA family

40

208

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.9012 19 177
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.8843 19 177
4dwl-assembly1.cif.gz_E avd molecule from bordetella bacteriophage dgr 0.649 34 138
7rro-assembly1.cif.gz_C5 structure of the 48-nm repeat doublet microtubule from bovine tracheal cilia 0.6371 16 156
7rro-assembly1.cif.gz_C5 structure of the 48-nm repeat doublet microtubule from bovine tracheal cilia 0.6266 16 156
ID Description Score Start End Superfamily
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8326 14 188 1.20.1440.20
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8106 14 188 1.20.1440.20
af_I6YDV4_1_171_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7327 2 177 1.10.287.1490
af_I6YDV4_1_171_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6678 2 177 1.10.287.1490
4onsC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6496 14 117 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A2V6BI24-F1-model_v4 LemA family protein 0.963 2 173 GO:0016020
AF-A0A351Y496-F1-model_v4 LemA protein 0.962 2 176 GO:0016020
AF-A0A1V5SLZ8-F1-model_v4 LemA family protein 0.9601 2 188 GO:0016020
AF-A0A4Q3R6K2-F1-model_v4 LemA family protein 0.959 13 189 GO:0016020
AF-A0A3P5VPY5-F1-model_v4 deleted 0.9587 22 188

Feature Viewer

pLDDT pTM Quality
63.1 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map