F249569
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 167 | 124 | 334 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300003187|JGI25151J46595_10006190|JGI25151J46595_100061906 |
| Length | 254 |
| Sequence | MNNQWGWYSADYSFLKFLLRMLIRKEMVSLIPNILIVDDDPHIRELVSVFLEREGFQTYEAIDGLDALQKIDEVKVDMVILDIMMPNMDGFDVCFELRKYYDIPILMLTAKGETSQKVKGFHLGTDDYLVKPFDPIELVVRVKALLKRYQITVSQSIQVGNVLLNRKTFEVKLEEKTVTLPLKEFELLFTLGSKAGRTCSREQLIEDVWGYDFEGNERTLDVHINRLREKFQEEKSKFSIKTIRGLGYRLEVSK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 4 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 17 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 18 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 19 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 20 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 21 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 22 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 35 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 36 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 37 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 38 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 39 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 40 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 50 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 53 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 54 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 55 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 56 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 57 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 58 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 59 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 60 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 61 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 62 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 63 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 64 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 65 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 66 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 67 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 68 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 69 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 74 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 75 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 76 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 77 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 78 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 79 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 80 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 81 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 82 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 83 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 84 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 85 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 86 | 2571042588 | Paenibacillus zanthoxyli JH29 | Isolate | Unclassified |
| 87 | 2576861424 | Paenibacillus sabinae T27 | Isolate | Rhizosphere |
| 88 | 2579778775 | Paenibacillus durus P3L-5 | Isolate | Unclassified |
| 89 | 2600255286 | Paenibacillus sp. NFR01 | Isolate | Rhizoplane |
| 90 | 2619619294 | Paenibacillus durus ATCC 35681 | Isolate | Unclassified |
| 91 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 92 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 93 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 94 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 95 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 96 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 97 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 98 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 99 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 100 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 101 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 102 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 103 | 2881636855 | Paenibacillus sp. 7197 | Isolate | Rhizosphere |
| 104 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 105 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 106 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 107 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 108 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 109 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 110 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 111 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 112 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 113 | 2971511577 | Paenibacillus apii 7124 | Isolate | Rhizosphere |
| 114 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 115 | 2980176882 | Paenibacillus apii 7028 | Isolate | Rhizosphere |
| 116 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 117 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 118 | 8007375930 | Clostridium sp. YIM B02565 | Isolate | Unclassified |
| 119 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 120 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 121 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 122 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 123 | 8055531788 | Lysinibacillus pakistanensis LY1 | Isolate | Rhizosphere |
| 124 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.05 |
| Metatranscriptomes | 0 |
| Isolates | 23.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.57 |
| Nodule | 2.4 |
| Rhizoplane | 2.4 |
| Rhizosphere | 55.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10006190 | 3300003187 | Bacteria | 6057 |
| 2 | JGI25159J45721_1001616 | 3300002987 | Bacteria | 9208 |
| 3 | JGI25151J46595_10003816 | 3300003187 | Bacteria | 8167 |
| 4 | JGI25151J46595_10010972 | 3300003187 | Bacteria | 4187 |
| 5 | JGI25151J46595_10036843 | 3300003187 | Bacteria | 1841 |
| 6 | JGI25151J46595_10041671 | 3300003187 | Bacteria | 1665 |
| 7 | Ga0055532_1007958 | 3300003758 | Bacteria | 1340 |
| 8 | Ga0055536_1012328 | 3300003781 | Bacteria | 3182 |
| 9 | Ga0070683_100095222 | 3300005329 | Bacteria | 2799 |
| 10 | Ga0070713_100323350 | 3300005436 | Bacteria | 1425 |
| 11 | Ga0070705_100433145 | 3300005440 | Bacteria | 982 |
| 12 | Ga0070694_100320326 | 3300005444 | Bacteria | 1193 |
| 13 | Ga0070708_100073105 | 3300005445 | Bacteria | 3090 |
| 14 | Ga0070681_10727823 | 3300005458 | Bacteria | 908 |
| 15 | Ga0070706_100003691 | 3300005467 | Bacteria | 14983 |
| 16 | Ga0070706_100167939 | 3300005467 | Bacteria | 2049 |
| 17 | Ga0070707_100021373 | 3300005468 | Bacteria | 6116 |
| 18 | Ga0070699_100393144 | 3300005518 | Bacteria | 1253 |
| 19 | Ga0070684_100012598 | 3300005535 | Bacteria | 6782 |
| 20 | Ga0070684_100137337 | 3300005535 | Bacteria | 2209 |
| 21 | Ga0070697_100439806 | 3300005536 | Bacteria | 1135 |
| 22 | Ga0068861_100784694 | 3300005719 | Bacteria | 893 |
| 23 | Ga0068860_100183652 | 3300005843 | Bacteria | 2022 |
| 24 | Ga0075431_100010021 | 3300006847 | Bacteria | 9519 |
| 25 | Ga0075431_100059080 | 3300006847 | Bacteria | 3957 |
| 26 | Ga0075433_10018251 | 3300006852 | Bacteria | 5827 |
| 27 | Ga0075433_10148185 | 3300006852 | Bacteria | 2087 |
| 28 | Ga0075434_100060123 | 3300006871 | Bacteria | 3779 |
| 29 | Ga0079104_1002519 | 3300006946 | Bacteria | 9729 |
| 30 | Ga0105251_10037567 | 3300009011 | Bacteria | 2376 |
| 31 | Ga0105244_10016686 | 3300009036 | Bacteria | 4176 |
| 32 | Ga0105244_10178465 | 3300009036 | Bacteria | 1008 |
| 33 | Ga0105250_10007967 | 3300009092 | Bacteria | 4525 |
| 34 | Ga0105250_10114048 | 3300009092 | Bacteria | 1108 |
| 35 | Ga0105240_10231184 | 3300009093 | Bacteria | 2149 |
| 36 | Ga0105240_10286611 | 3300009093 | Bacteria | 1890 |
| 37 | Ga0105242_10311817 | 3300009176 | Bacteria | 1440 |
| 38 | Ga0105248_10091186 | 3300009177 | Bacteria | 3432 |
| 39 | Ga0105237_10052567 | 3300009545 | Bacteria | 4089 |
| 40 | Ga0105237_10085682 | 3300009545 | Bacteria | 3140 |
| 41 | Ga0105246_10048740 | 3300011119 | Bacteria | 2897 |
| 42 | Ga0157378_10577933 | 3300013297 | Bacteria | 1132 |
| 43 | Ga0163162_10330989 | 3300013306 | Bacteria | 1656 |
| 44 | Ga0157375_10596233 | 3300013308 | Bacteria | 1264 |
| 45 | Ga0163163_10033430 | 3300014325 | Bacteria | 4975 |
| 46 | Ga0209784_100107 | 3300025224 | Bacteria | 95294 |
| 47 | Ga0209147_102851 | 3300025229 | Bacteria | 3832 |
| 48 | Ga0209130_1000539 | 3300025284 | Bacteria | 38091 |
| 49 | Ga0209130_1006330 | 3300025284 | Bacteria | 3866 |
| 50 | Ga0209675_1003958 | 3300025291 | Bacteria | 6779 |
| 51 | Ga0209676_1034335 | 3300025292 | Bacteria | 1501 |
| 52 | Ga0209676_1035006 | 3300025292 | Bacteria | 1478 |
| 53 | Ga0209025_1000595 | 3300025294 | Bacteria | 65245 |
| 54 | Ga0209025_1001939 | 3300025294 | Bacteria | 23880 |
| 55 | Ga0209025_1004369 | 3300025294 | Bacteria | 12319 |
| 56 | Ga0209025_1008513 | 3300025294 | Bacteria | 7374 |
| 57 | Ga0209025_1012033 | 3300025294 | Bacteria | 5607 |
| 58 | Ga0209025_1012079 | 3300025294 | Bacteria | 5591 |
| 59 | Ga0209025_1024929 | 3300025294 | Bacteria | 3067 |
| 60 | Ga0209025_1026804 | 3300025294 | Bacteria | 2879 |
| 61 | Ga0209025_1036534 | 3300025294 | Bacteria | 2198 |
| 62 | Ga0209025_1049157 | 3300025294 | Bacteria | 1701 |
| 63 | Ga0209025_1055052 | 3300025294 | Bacteria | 1542 |
| 64 | Ga0207655_1021007 | 3300025728 | Bacteria | 3330 |
| 65 | Ga0207684_10001954 | 3300025910 | Bacteria | 21332 |
| 66 | Ga0207684_10002776 | 3300025910 | Bacteria | 17445 |
| 67 | Ga0207684_10019916 | 3300025910 | Bacteria | 5734 |
| 68 | Ga0207671_10076316 | 3300025914 | Bacteria | 2508 |
| 69 | Ga0207671_10095928 | 3300025914 | Bacteria | 2240 |
| 70 | Ga0207646_10018331 | 3300025922 | Bacteria | 6530 |
| 71 | Ga0207646_10931625 | 3300025922 | Bacteria | 770 |
| 72 | Ga0207711_10109731 | 3300025941 | Bacteria | 2452 |
| 73 | Ga0207661_10016021 | 3300025944 | Bacteria | 5527 |
| 74 | Ga0207661_10373494 | 3300025944 | Bacteria | 1290 |
| 75 | Ga0207668_10616154 | 3300025972 | Bacteria | 947 |
| 76 | Ga0207708_10139665 | 3300026075 | Bacteria | 1899 |
| 77 | Ga0207641_10865016 | 3300026088 | Bacteria | 897 |
| 78 | Ga0209281_1000449 | 3300027111 | Bacteria | 58884 |
| 79 | Ga0209281_1000474 | 3300027111 | Bacteria | 56152 |
| 80 | Ga0268265_10709423 | 3300028380 | Bacteria | 973 |
| 81 | Ga0268264_10320979 | 3300028381 | Bacteria | 1464 |
| 82 | Ga0265338_10059735 | 3300028800 | Unclassified | 3357 |
| 83 | Ga0265338_10184350 | 3300028800 | Bacteria | 1588 |
| 84 | Ga0237817_10042 | 3300030083 | Bacteria | 44083 |
| 85 | Ga0265320_10023458 | 3300031240 | Bacteria | 3284 |
| 86 | Ga0265320_10061171 | 3300031240 | Bacteria | 1796 |
| 87 | Ga0373955_0081882 | 3300035172 | Bacteria | 1826 |
| 88 | Ga0373931_0506040 | 3300035691 | Bacteria | 780 |
| 89 | Ga0373935_0315013 | 3300035692 | Bacteria | 1109 |
| 90 | Ga0373937_0466814 | 3300036401 | Bacteria | 1199 |
| 91 | Ga0395899_0056736 | 3300037312 | Bacteria | 2893 |
| 92 | Ga0395899_0201073 | 3300037312 | Bacteria | 1389 |
| 93 | Ga0395899_0316150 | 3300037312 | Bacteria | 1053 |
| 94 | Ga0237819_00021 | 3300038705 | Bacteria | 53182 |
| 95 | Ga0237819_00179 | 3300038705 | Bacteria | 23301 |
| 96 | Ga0436365_0677182 | 3300039437 | Bacteria | 1128 |
| 97 | Ga0466969_0000657 | 3300044656 | Bacteria | 18777 |
| 98 | Ga0466961_0022197 | 3300044693 | Bacteria | 4083 |
| 99 | Ga0453684_0011226 | 3300044712 | Bacteria | 15078 |
| 100 | Ga0453684_1134908 | 3300044712 | Bacteria | 824 |
| 101 | Ga0466968_0010075 | 3300044735 | Bacteria | 3653 |
| 102 | Ga0466957_0144399 | 3300044842 | Bacteria | 1535 |
| 103 | Ga0466959_0000512 | 3300045049 | Bacteria | 22515 |
| 104 | Ga0466967_0023341 | 3300045976 | Bacteria | 5066 |
| 105 | Ga0495630_0152868 | 3300046517 | Bacteria | 1756 |
| 106 | Ga0495667_0267839 | 3300046559 | Bacteria | 1086 |
| 107 | Ga0495660_0040789 | 3300046810 | Bacteria | 2572 |
| 108 | Ga0495672_0009070 | 3300047320 | Bacteria | 7253 |
| 109 | Ga0496108_0000331 | 3300048911 | Bacteria | 40093 |
| 110 | Ga0496110_0000509 | 3300048913 | Bacteria | 26398 |
| 111 | Ga0496110_0052560 | 3300048913 | Bacteria | 3580 |
| 112 | Ga0496116_0042130 | 3300048919 | Bacteria | 3125 |
| 113 | Ga0496120_0004590 | 3300048923 | Bacteria | 11500 |
| 114 | Ga0496122_0000289 | 3300048925 | Bacteria | 111591 |
| 115 | Ga0496122_0001721 | 3300048925 | Bacteria | 33957 |
| 116 | Ga0496122_0008545 | 3300048925 | Bacteria | 11013 |
| 117 | Ga0496122_0205905 | 3300048925 | Bacteria | 1145 |
| 118 | Ga0496123_0015736 | 3300048926 | Bacteria | 6187 |
| 119 | Ga0496125_0004006 | 3300048928 | Bacteria | 17319 |
| 120 | Ga0496126_0000203 | 3300048929 | Bacteria | 132651 |
| 121 | Ga0496126_0000600 | 3300048929 | Bacteria | 68017 |
| 122 | Ga0496126_0665650 | 3300048929 | Bacteria | 813 |
| 123 | Ga0501034_0175810 | 3300049571 | Bacteria | 2107 |
| 124 | Ga0501080_0431624 | 3300049742 | Bacteria | 1183 |
| 125 | nmdc:mga06r32_1050_c1 | 3300050510 | Bacteria | 24930 |
| 126 | nmdc:mga06r32_50231_c1 | 3300050510 | Bacteria | 3989 |
| 127 | Ga0466962_0058266 | 3300061719 | Bacteria | 1844 |
| 128 | 2553395220 | 2551306519 | Bacteria | 5465154 |
| 129 | 2573038553 | 2571042588 | Bacteria | 5045676 |
| 130 | 2578339087 | 2576861424 | Bacteria | 5270569 |
| 131 | 2580935325 | 2579778775 | Bacteria | 5360914 |
| 132 | 2601640351 | 2600255286 | Bacteria | 5390125 |
| 133 | 2621277539 | 2619619294 | Bacteria | 5575484 |
| 134 | 2644704394 | 2643221729 | Bacteria | 6621700 |
| 135 | 2644709088 | 2643221730 | Bacteria | 6523787 |
| 136 | 2685149837 | 2684622632 | Bacteria | 5380049 |
| 137 | 2698323362 | 2695420987 | Bacteria | 6152737 |
| 138 | 2705993810 | 2703719227 | Bacteria | 5631989 |
| 139 | 2721505188 | 2718218445 | Bacteria | 5113413 |
| 140 | 2739159143 | 2738541358 | Bacteria | 5932299 |
| 141 | 2739211803 | 2738543006 | Bacteria | 5904091 |
| 142 | 2791212797 | 2788500588 | Bacteria | 4584915 |
| 143 | 2819579032 | 2818991443 | Bacteria | 6598732 |
| 144 | 2819626949 | 2818991451 | Bacteria | 4697364 |
| 145 | 2865003009 | 2865002811 | Bacteria | 6333767 |
| 146 | 2881641884 | 2881636855 | Bacteria | 5205297 |
| 147 | 2904117583 | 2904113452 | Bacteria | 7796941 |
| 148 | 2904164932 | 2904162308 | Bacteria | 7086713 |
| 149 | 2904607060 | 2904606771 | Bacteria | 4684500 |
| 150 | 2929235099 | 2929233124 | Bacteria | 5948380 |
| 151 | 2938919275 | 2938917290 | Bacteria | 5914775 |
| 152 | 2947428649 | 2947426588 | Bacteria | 5357194 |
| 153 | 2965763143 | 2965761152 | Bacteria | 5806513 |
| 154 | 2971410277 | 2971403814 | Bacteria | 7370929 |
| 155 | 2971411176 | 2971410472 | Bacteria | 8311090 |
| 156 | 2971514310 | 2971511577 | Bacteria | 5404012 |
| 157 | 2979085581 | 2979083700 | Bacteria | 5894929 |
| 158 | 2980180524 | 2980176882 | Bacteria | 5397533 |
| 159 | 3001272236 | 3001272096 | Bacteria | 4729684 |
| 160 | 3006977930 | 3006973921 | Bacteria | 4423788 |
| 161 | 8007378414 | 8007375930 | Bacteria | 4080554 |
| 162 | 8022625901 | 8022621104 | Bacteria | 5241040 |
| 163 | 8023444527 | 8023438354 | Bacteria | 5779374 |
| 164 | 8023448369 | 8023444577 | Bacteria | 5661597 |
| 165 | 8054803123 | 8054795415 | Bacteria | 9785225 |
| 166 | 8055533532 | 8055531788 | Bacteria | 5249694 |
| 167 | 8056537031 | 8056533031 | Bacteria | 8964429 |
| 168 | JGI25151J46595_10006190 | |||
| 169 | JGI25159J45721_1001616 | |||
| 170 | JGI25151J46595_10003816 | |||
| 171 | JGI25151J46595_10010972 | |||
| 172 | JGI25151J46595_10036843 | |||
| 173 | JGI25151J46595_10041671 | |||
| 174 | Ga0055532_1007958 | |||
| 175 | Ga0055536_1012328 | |||
| 176 | Ga0070683_100095222 | |||
| 177 | Ga0070713_100323350 | |||
| 178 | Ga0070705_100433145 | |||
| 179 | Ga0070694_100320326 | |||
| 180 | Ga0070708_100073105 | |||
| 181 | Ga0070681_10727823 | |||
| 182 | Ga0070706_100003691 | |||
| 183 | Ga0070706_100167939 | |||
| 184 | Ga0070707_100021373 | |||
| 185 | Ga0070699_100393144 | |||
| 186 | Ga0070684_100012598 | |||
| 187 | Ga0070684_100137337 | |||
| 188 | Ga0070697_100439806 | |||
| 189 | Ga0068861_100784694 | |||
| 190 | Ga0068860_100183652 | |||
| 191 | Ga0075431_100010021 | |||
| 192 | Ga0075431_100059080 | |||
| 193 | Ga0075433_10018251 | |||
| 194 | Ga0075433_10148185 | |||
| 195 | Ga0075434_100060123 | |||
| 196 | Ga0079104_1002519 | |||
| 197 | Ga0105251_10037567 | |||
| 198 | Ga0105244_10016686 | |||
| 199 | Ga0105244_10178465 | |||
| 200 | Ga0105250_10007967 | |||
| 201 | Ga0105250_10114048 | |||
| 202 | Ga0105240_10231184 | |||
| 203 | Ga0105240_10286611 | |||
| 204 | Ga0105242_10311817 | |||
| 205 | Ga0105248_10091186 | |||
| 206 | Ga0105237_10052567 | |||
| 207 | Ga0105237_10085682 | |||
| 208 | Ga0105246_10048740 | |||
| 209 | Ga0157378_10577933 | |||
| 210 | Ga0163162_10330989 | |||
| 211 | Ga0157375_10596233 | |||
| 212 | Ga0163163_10033430 | |||
| 213 | Ga0209784_100107 | |||
| 214 | Ga0209147_102851 | |||
| 215 | Ga0209130_1000539 | |||
| 216 | Ga0209130_1006330 | |||
| 217 | Ga0209675_1003958 | |||
| 218 | Ga0209676_1034335 | |||
| 219 | Ga0209676_1035006 | |||
| 220 | Ga0209025_1000595 | |||
| 221 | Ga0209025_1001939 | |||
| 222 | Ga0209025_1004369 | |||
| 223 | Ga0209025_1008513 | |||
| 224 | Ga0209025_1012033 | |||
| 225 | Ga0209025_1012079 | |||
| 226 | Ga0209025_1024929 | |||
| 227 | Ga0209025_1026804 | |||
| 228 | Ga0209025_1036534 | |||
| 229 | Ga0209025_1049157 | |||
| 230 | Ga0209025_1055052 | |||
| 231 | Ga0207655_1021007 | |||
| 232 | Ga0207684_10001954 | |||
| 233 | Ga0207684_10002776 | |||
| 234 | Ga0207684_10019916 | |||
| 235 | Ga0207671_10076316 | |||
| 236 | Ga0207671_10095928 | |||
| 237 | Ga0207646_10018331 | |||
| 238 | Ga0207646_10931625 | |||
| 239 | Ga0207711_10109731 | |||
| 240 | Ga0207661_10016021 | |||
| 241 | Ga0207661_10373494 | |||
| 242 | Ga0207668_10616154 | |||
| 243 | Ga0207708_10139665 | |||
| 244 | Ga0207641_10865016 | |||
| 245 | Ga0209281_1000449 | |||
| 246 | Ga0209281_1000474 | |||
| 247 | Ga0268265_10709423 | |||
| 248 | Ga0268264_10320979 | |||
| 249 | Ga0265338_10059735 | |||
| 250 | Ga0265338_10184350 | |||
| 251 | Ga0237817_10042 | |||
| 252 | Ga0265320_10023458 | |||
| 253 | Ga0265320_10061171 | |||
| 254 | Ga0373955_0081882 | |||
| 255 | Ga0373931_0506040 | |||
| 256 | Ga0373935_0315013 | |||
| 257 | Ga0373937_0466814 | |||
| 258 | Ga0395899_0056736 | |||
| 259 | Ga0395899_0201073 | |||
| 260 | Ga0395899_0316150 | |||
| 261 | Ga0237819_00021 | |||
| 262 | Ga0237819_00179 | |||
| 263 | Ga0436365_0677182 | |||
| 264 | Ga0466969_0000657 | |||
| 265 | Ga0466961_0022197 | |||
| 266 | Ga0453684_0011226 | |||
| 267 | Ga0453684_1134908 | |||
| 268 | Ga0466968_0010075 | |||
| 269 | Ga0466957_0144399 | |||
| 270 | Ga0466959_0000512 | |||
| 271 | Ga0466967_0023341 | |||
| 272 | Ga0495630_0152868 | |||
| 273 | Ga0495667_0267839 | |||
| 274 | Ga0495660_0040789 | |||
| 275 | Ga0495672_0009070 | |||
| 276 | Ga0496108_0000331 | |||
| 277 | Ga0496110_0000509 | |||
| 278 | Ga0496110_0052560 | |||
| 279 | Ga0496116_0042130 | |||
| 280 | Ga0496120_0004590 | |||
| 281 | Ga0496122_0000289 | |||
| 282 | Ga0496122_0001721 | |||
| 283 | Ga0496122_0008545 | |||
| 284 | Ga0496122_0205905 | |||
| 285 | Ga0496123_0015736 | |||
| 286 | Ga0496125_0004006 | |||
| 287 | Ga0496126_0000203 | |||
| 288 | Ga0496126_0000600 | |||
| 289 | Ga0496126_0665650 | |||
| 290 | Ga0501034_0175810 | |||
| 291 | Ga0501080_0431624 | |||
| 292 | nmdc:mga06r32_1050_c1 | |||
| 293 | nmdc:mga06r32_50231_c1 | |||
| 294 | Ga0466962_0058266 | |||
| 295 | 2553395220 | |||
| 296 | 2573038553 | |||
| 297 | 2578339087 | |||
| 298 | 2580935325 | |||
| 299 | 2601640351 | |||
| 300 | 2621277539 | |||
| 301 | 2644704394 | |||
| 302 | 2644709088 | |||
| 303 | 2685149837 | |||
| 304 | 2698323362 | |||
| 305 | 2705993810 | |||
| 306 | 2721505188 | |||
| 307 | 2739159143 | |||
| 308 | 2739211803 | |||
| 309 | 2791212797 | |||
| 310 | 2819579032 | |||
| 311 | 2819626949 | |||
| 312 | 2865003009 | |||
| 313 | 2881641884 | |||
| 314 | 2904117583 | |||
| 315 | 2904164932 | |||
| 316 | 2904607060 | |||
| 317 | 2929235099 | |||
| 318 | 2938919275 | |||
| 319 | 2947428649 | |||
| 320 | 2965763143 | |||
| 321 | 2971410277 | |||
| 322 | 2971411176 | |||
| 323 | 2971514310 | |||
| 324 | 2979085581 | |||
| 325 | 2980180524 | |||
| 326 | 3001272236 | |||
| 327 | 3006977930 | |||
| 328 | 8007378414 | |||
| 329 | 8022625901 | |||
| 330 | 8023444527 | |||
| 331 | 8023448369 | |||
| 332 | 8054803123 | |||
| 333 | 8055533532 | |||
| 334 | 8056537031 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9845 | 4 | 119 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9839 | 4 | 119 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9828 | 2 | 121 |
| 1nxx-assembly1.cif.gz_A-2 | micarec ph 5.5 | 0.9779 | 4 | 119 |
| 6rh1-assembly1.cif.gz_C | revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 | 0.9757 | 3 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVQ9_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9772 | 4 | 81 | 3.40.50.2300 |
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9759 | 4 | 78 | 3.40.50.2300 |
| af_Q06065_2_134_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.975 | 1 | 124 | 3.40.50.2300 |
| 1nxoA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9734 | 4 | 121 | 3.40.50.2300 |
| 4d6yA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9698 | 5 | 117 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C0YNE6-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9794 | 3 | 118 |
GO:0000160
GO:0006935 GO:0016301 |
| AF-A0A7V4EM72-F1-model_v4 | Sigma-54-dependent Fis family transcriptional regulator | 0.9793 | 2 | 124 |
GO:0000160
GO:0005524 GO:0006355 GO:0016887 GO:0043565 |
| AF-A0A534PI46-F1-model_v4 | Sigma-54-dependent Fis family transcriptional regulator | 0.9791 | 2 | 117 |
GO:0000160
GO:0005524 GO:0006355 GO:0016887 GO:0043565 |
| AF-A0A7V0ULA9-F1-model_v4 | Response regulator | 0.9761 | 2 | 121 |
GO:0000160
|
| AF-A0A661UAC1-F1-model_v4 | Sigma-54-dependent Fis family transcriptional regulator | 0.976 | 2 | 123 |
GO:0000160
GO:0005524 GO:0006355 GO:0016887 GO:0043565 |