F249569

General Info

Members Datasets Scaffolds Average Seq Length
167 124 334 225

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10006190|JGI25151J46595_100061906
Length 254
Sequence MNNQWGWYSADYSFLKFLLRMLIRKEMVSLIPNILIVDDDPHIRELVSVFLEREGFQTYEAIDGLDALQKIDEVKVDMVILDIMMPNMDGFDVCFELRKYYDIPILMLTAKGETSQKVKGFHLGTDDYLVKPFDPIELVVRVKALLKRYQITVSQSIQVGNVLLNRKTFEVKLEEKTVTLPLKEFELLFTLGSKAGRTCSREQLIEDVWGYDFEGNERTLDVHINRLREKFQEEKSKFSIKTIRGLGYRLEVSK

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
22 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
23 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
24 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
37 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
54 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
55 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
56 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
57 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
61 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
62 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
66 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
70 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
71 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
72 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
73 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
74 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
75 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
76 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
77 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
78 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
79 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
80 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
83 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
84 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
85 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
86 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
87 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
88 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
89 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
90 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
91 2643221729 Bacillus sp. Root11 Isolate Unclassified
92 2643221730 Bacillus sp. Root131 Isolate Unclassified
93 2684622632 Bacillus cereus 905 Isolate Unclassified
94 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
95 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
96 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
97 2738541358 Bacillus sp. OV752 Isolate Unclassified
98 2738543006 Bacillus sp. OK077 Isolate Unclassified
99 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
100 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
101 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
102 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
103 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
104 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
105 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
106 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
107 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
108 2938917290 Bacillus sp. CR71 Isolate Unclassified
109 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
110 2965761152 Bacillus sp. COPE52 Isolate Unclassified
111 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
112 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
113 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
114 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
115 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
116 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
117 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
118 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
119 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
120 8023438354 Bacillus sp. BH2 Isolate Unclassified
121 8023444577 Bacillus sp. BH32 Isolate Unclassified
122 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
123 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
124 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.05
Metatranscriptomes 0
Isolates 23.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.57
Nodule 2.4
Rhizoplane 2.4
Rhizosphere 55.69
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10006190 3300003187 Bacteria 6057
2 JGI25159J45721_1001616 3300002987 Bacteria 9208
3 JGI25151J46595_10003816 3300003187 Bacteria 8167
4 JGI25151J46595_10010972 3300003187 Bacteria 4187
5 JGI25151J46595_10036843 3300003187 Bacteria 1841
6 JGI25151J46595_10041671 3300003187 Bacteria 1665
7 Ga0055532_1007958 3300003758 Bacteria 1340
8 Ga0055536_1012328 3300003781 Bacteria 3182
9 Ga0070683_100095222 3300005329 Bacteria 2799
10 Ga0070713_100323350 3300005436 Bacteria 1425
11 Ga0070705_100433145 3300005440 Bacteria 982
12 Ga0070694_100320326 3300005444 Bacteria 1193
13 Ga0070708_100073105 3300005445 Bacteria 3090
14 Ga0070681_10727823 3300005458 Bacteria 908
15 Ga0070706_100003691 3300005467 Bacteria 14983
16 Ga0070706_100167939 3300005467 Bacteria 2049
17 Ga0070707_100021373 3300005468 Bacteria 6116
18 Ga0070699_100393144 3300005518 Bacteria 1253
19 Ga0070684_100012598 3300005535 Bacteria 6782
20 Ga0070684_100137337 3300005535 Bacteria 2209
21 Ga0070697_100439806 3300005536 Bacteria 1135
22 Ga0068861_100784694 3300005719 Bacteria 893
23 Ga0068860_100183652 3300005843 Bacteria 2022
24 Ga0075431_100010021 3300006847 Bacteria 9519
25 Ga0075431_100059080 3300006847 Bacteria 3957
26 Ga0075433_10018251 3300006852 Bacteria 5827
27 Ga0075433_10148185 3300006852 Bacteria 2087
28 Ga0075434_100060123 3300006871 Bacteria 3779
29 Ga0079104_1002519 3300006946 Bacteria 9729
30 Ga0105251_10037567 3300009011 Bacteria 2376
31 Ga0105244_10016686 3300009036 Bacteria 4176
32 Ga0105244_10178465 3300009036 Bacteria 1008
33 Ga0105250_10007967 3300009092 Bacteria 4525
34 Ga0105250_10114048 3300009092 Bacteria 1108
35 Ga0105240_10231184 3300009093 Bacteria 2149
36 Ga0105240_10286611 3300009093 Bacteria 1890
37 Ga0105242_10311817 3300009176 Bacteria 1440
38 Ga0105248_10091186 3300009177 Bacteria 3432
39 Ga0105237_10052567 3300009545 Bacteria 4089
40 Ga0105237_10085682 3300009545 Bacteria 3140
41 Ga0105246_10048740 3300011119 Bacteria 2897
42 Ga0157378_10577933 3300013297 Bacteria 1132
43 Ga0163162_10330989 3300013306 Bacteria 1656
44 Ga0157375_10596233 3300013308 Bacteria 1264
45 Ga0163163_10033430 3300014325 Bacteria 4975
46 Ga0209784_100107 3300025224 Bacteria 95294
47 Ga0209147_102851 3300025229 Bacteria 3832
48 Ga0209130_1000539 3300025284 Bacteria 38091
49 Ga0209130_1006330 3300025284 Bacteria 3866
50 Ga0209675_1003958 3300025291 Bacteria 6779
51 Ga0209676_1034335 3300025292 Bacteria 1501
52 Ga0209676_1035006 3300025292 Bacteria 1478
53 Ga0209025_1000595 3300025294 Bacteria 65245
54 Ga0209025_1001939 3300025294 Bacteria 23880
55 Ga0209025_1004369 3300025294 Bacteria 12319
56 Ga0209025_1008513 3300025294 Bacteria 7374
57 Ga0209025_1012033 3300025294 Bacteria 5607
58 Ga0209025_1012079 3300025294 Bacteria 5591
59 Ga0209025_1024929 3300025294 Bacteria 3067
60 Ga0209025_1026804 3300025294 Bacteria 2879
61 Ga0209025_1036534 3300025294 Bacteria 2198
62 Ga0209025_1049157 3300025294 Bacteria 1701
63 Ga0209025_1055052 3300025294 Bacteria 1542
64 Ga0207655_1021007 3300025728 Bacteria 3330
65 Ga0207684_10001954 3300025910 Bacteria 21332
66 Ga0207684_10002776 3300025910 Bacteria 17445
67 Ga0207684_10019916 3300025910 Bacteria 5734
68 Ga0207671_10076316 3300025914 Bacteria 2508
69 Ga0207671_10095928 3300025914 Bacteria 2240
70 Ga0207646_10018331 3300025922 Bacteria 6530
71 Ga0207646_10931625 3300025922 Bacteria 770
72 Ga0207711_10109731 3300025941 Bacteria 2452
73 Ga0207661_10016021 3300025944 Bacteria 5527
74 Ga0207661_10373494 3300025944 Bacteria 1290
75 Ga0207668_10616154 3300025972 Bacteria 947
76 Ga0207708_10139665 3300026075 Bacteria 1899
77 Ga0207641_10865016 3300026088 Bacteria 897
78 Ga0209281_1000449 3300027111 Bacteria 58884
79 Ga0209281_1000474 3300027111 Bacteria 56152
80 Ga0268265_10709423 3300028380 Bacteria 973
81 Ga0268264_10320979 3300028381 Bacteria 1464
82 Ga0265338_10059735 3300028800 Unclassified 3357
83 Ga0265338_10184350 3300028800 Bacteria 1588
84 Ga0237817_10042 3300030083 Bacteria 44083
85 Ga0265320_10023458 3300031240 Bacteria 3284
86 Ga0265320_10061171 3300031240 Bacteria 1796
87 Ga0373955_0081882 3300035172 Bacteria 1826
88 Ga0373931_0506040 3300035691 Bacteria 780
89 Ga0373935_0315013 3300035692 Bacteria 1109
90 Ga0373937_0466814 3300036401 Bacteria 1199
91 Ga0395899_0056736 3300037312 Bacteria 2893
92 Ga0395899_0201073 3300037312 Bacteria 1389
93 Ga0395899_0316150 3300037312 Bacteria 1053
94 Ga0237819_00021 3300038705 Bacteria 53182
95 Ga0237819_00179 3300038705 Bacteria 23301
96 Ga0436365_0677182 3300039437 Bacteria 1128
97 Ga0466969_0000657 3300044656 Bacteria 18777
98 Ga0466961_0022197 3300044693 Bacteria 4083
99 Ga0453684_0011226 3300044712 Bacteria 15078
100 Ga0453684_1134908 3300044712 Bacteria 824
101 Ga0466968_0010075 3300044735 Bacteria 3653
102 Ga0466957_0144399 3300044842 Bacteria 1535
103 Ga0466959_0000512 3300045049 Bacteria 22515
104 Ga0466967_0023341 3300045976 Bacteria 5066
105 Ga0495630_0152868 3300046517 Bacteria 1756
106 Ga0495667_0267839 3300046559 Bacteria 1086
107 Ga0495660_0040789 3300046810 Bacteria 2572
108 Ga0495672_0009070 3300047320 Bacteria 7253
109 Ga0496108_0000331 3300048911 Bacteria 40093
110 Ga0496110_0000509 3300048913 Bacteria 26398
111 Ga0496110_0052560 3300048913 Bacteria 3580
112 Ga0496116_0042130 3300048919 Bacteria 3125
113 Ga0496120_0004590 3300048923 Bacteria 11500
114 Ga0496122_0000289 3300048925 Bacteria 111591
115 Ga0496122_0001721 3300048925 Bacteria 33957
116 Ga0496122_0008545 3300048925 Bacteria 11013
117 Ga0496122_0205905 3300048925 Bacteria 1145
118 Ga0496123_0015736 3300048926 Bacteria 6187
119 Ga0496125_0004006 3300048928 Bacteria 17319
120 Ga0496126_0000203 3300048929 Bacteria 132651
121 Ga0496126_0000600 3300048929 Bacteria 68017
122 Ga0496126_0665650 3300048929 Bacteria 813
123 Ga0501034_0175810 3300049571 Bacteria 2107
124 Ga0501080_0431624 3300049742 Bacteria 1183
125 nmdc:mga06r32_1050_c1 3300050510 Bacteria 24930
126 nmdc:mga06r32_50231_c1 3300050510 Bacteria 3989
127 Ga0466962_0058266 3300061719 Bacteria 1844
128 2553395220 2551306519 Bacteria 5465154
129 2573038553 2571042588 Bacteria 5045676
130 2578339087 2576861424 Bacteria 5270569
131 2580935325 2579778775 Bacteria 5360914
132 2601640351 2600255286 Bacteria 5390125
133 2621277539 2619619294 Bacteria 5575484
134 2644704394 2643221729 Bacteria 6621700
135 2644709088 2643221730 Bacteria 6523787
136 2685149837 2684622632 Bacteria 5380049
137 2698323362 2695420987 Bacteria 6152737
138 2705993810 2703719227 Bacteria 5631989
139 2721505188 2718218445 Bacteria 5113413
140 2739159143 2738541358 Bacteria 5932299
141 2739211803 2738543006 Bacteria 5904091
142 2791212797 2788500588 Bacteria 4584915
143 2819579032 2818991443 Bacteria 6598732
144 2819626949 2818991451 Bacteria 4697364
145 2865003009 2865002811 Bacteria 6333767
146 2881641884 2881636855 Bacteria 5205297
147 2904117583 2904113452 Bacteria 7796941
148 2904164932 2904162308 Bacteria 7086713
149 2904607060 2904606771 Bacteria 4684500
150 2929235099 2929233124 Bacteria 5948380
151 2938919275 2938917290 Bacteria 5914775
152 2947428649 2947426588 Bacteria 5357194
153 2965763143 2965761152 Bacteria 5806513
154 2971410277 2971403814 Bacteria 7370929
155 2971411176 2971410472 Bacteria 8311090
156 2971514310 2971511577 Bacteria 5404012
157 2979085581 2979083700 Bacteria 5894929
158 2980180524 2980176882 Bacteria 5397533
159 3001272236 3001272096 Bacteria 4729684
160 3006977930 3006973921 Bacteria 4423788
161 8007378414 8007375930 Bacteria 4080554
162 8022625901 8022621104 Bacteria 5241040
163 8023444527 8023438354 Bacteria 5779374
164 8023448369 8023444577 Bacteria 5661597
165 8054803123 8054795415 Bacteria 9785225
166 8055533532 8055531788 Bacteria 5249694
167 8056537031 8056533031 Bacteria 8964429
168 JGI25151J46595_10006190
169 JGI25159J45721_1001616
170 JGI25151J46595_10003816
171 JGI25151J46595_10010972
172 JGI25151J46595_10036843
173 JGI25151J46595_10041671
174 Ga0055532_1007958
175 Ga0055536_1012328
176 Ga0070683_100095222
177 Ga0070713_100323350
178 Ga0070705_100433145
179 Ga0070694_100320326
180 Ga0070708_100073105
181 Ga0070681_10727823
182 Ga0070706_100003691
183 Ga0070706_100167939
184 Ga0070707_100021373
185 Ga0070699_100393144
186 Ga0070684_100012598
187 Ga0070684_100137337
188 Ga0070697_100439806
189 Ga0068861_100784694
190 Ga0068860_100183652
191 Ga0075431_100010021
192 Ga0075431_100059080
193 Ga0075433_10018251
194 Ga0075433_10148185
195 Ga0075434_100060123
196 Ga0079104_1002519
197 Ga0105251_10037567
198 Ga0105244_10016686
199 Ga0105244_10178465
200 Ga0105250_10007967
201 Ga0105250_10114048
202 Ga0105240_10231184
203 Ga0105240_10286611
204 Ga0105242_10311817
205 Ga0105248_10091186
206 Ga0105237_10052567
207 Ga0105237_10085682
208 Ga0105246_10048740
209 Ga0157378_10577933
210 Ga0163162_10330989
211 Ga0157375_10596233
212 Ga0163163_10033430
213 Ga0209784_100107
214 Ga0209147_102851
215 Ga0209130_1000539
216 Ga0209130_1006330
217 Ga0209675_1003958
218 Ga0209676_1034335
219 Ga0209676_1035006
220 Ga0209025_1000595
221 Ga0209025_1001939
222 Ga0209025_1004369
223 Ga0209025_1008513
224 Ga0209025_1012033
225 Ga0209025_1012079
226 Ga0209025_1024929
227 Ga0209025_1026804
228 Ga0209025_1036534
229 Ga0209025_1049157
230 Ga0209025_1055052
231 Ga0207655_1021007
232 Ga0207684_10001954
233 Ga0207684_10002776
234 Ga0207684_10019916
235 Ga0207671_10076316
236 Ga0207671_10095928
237 Ga0207646_10018331
238 Ga0207646_10931625
239 Ga0207711_10109731
240 Ga0207661_10016021
241 Ga0207661_10373494
242 Ga0207668_10616154
243 Ga0207708_10139665
244 Ga0207641_10865016
245 Ga0209281_1000449
246 Ga0209281_1000474
247 Ga0268265_10709423
248 Ga0268264_10320979
249 Ga0265338_10059735
250 Ga0265338_10184350
251 Ga0237817_10042
252 Ga0265320_10023458
253 Ga0265320_10061171
254 Ga0373955_0081882
255 Ga0373931_0506040
256 Ga0373935_0315013
257 Ga0373937_0466814
258 Ga0395899_0056736
259 Ga0395899_0201073
260 Ga0395899_0316150
261 Ga0237819_00021
262 Ga0237819_00179
263 Ga0436365_0677182
264 Ga0466969_0000657
265 Ga0466961_0022197
266 Ga0453684_0011226
267 Ga0453684_1134908
268 Ga0466968_0010075
269 Ga0466957_0144399
270 Ga0466959_0000512
271 Ga0466967_0023341
272 Ga0495630_0152868
273 Ga0495667_0267839
274 Ga0495660_0040789
275 Ga0495672_0009070
276 Ga0496108_0000331
277 Ga0496110_0000509
278 Ga0496110_0052560
279 Ga0496116_0042130
280 Ga0496120_0004590
281 Ga0496122_0000289
282 Ga0496122_0001721
283 Ga0496122_0008545
284 Ga0496122_0205905
285 Ga0496123_0015736
286 Ga0496125_0004006
287 Ga0496126_0000203
288 Ga0496126_0000600
289 Ga0496126_0665650
290 Ga0501034_0175810
291 Ga0501080_0431624
292 nmdc:mga06r32_1050_c1
293 nmdc:mga06r32_50231_c1
294 Ga0466962_0058266
295 2553395220
296 2573038553
297 2578339087
298 2580935325
299 2601640351
300 2621277539
301 2644704394
302 2644709088
303 2685149837
304 2698323362
305 2705993810
306 2721505188
307 2739159143
308 2739211803
309 2791212797
310 2819579032
311 2819626949
312 2865003009
313 2881641884
314 2904117583
315 2904164932
316 2904607060
317 2929235099
318 2938919275
319 2947428649
320 2965763143
321 2971410277
322 2971411176
323 2971514310
324 2979085581
325 2980180524
326 3001272236
327 3006977930
328 8007378414
329 8022625901
330 8023444527
331 8023448369
332 8054803123
333 8055533532
334 8056537031

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

34

143

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

175

250

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9845 4 119
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9839 4 119
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9828 2 121
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9779 4 119
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9757 3 117
ID Description Score Start End Superfamily
af_Q2FVQ9_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9772 4 81 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9759 4 78 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.975 1 124 3.40.50.2300
1nxoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9734 4 121 3.40.50.2300
4d6yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9698 5 117 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7C0YNE6-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9794 3 118 GO:0000160
GO:0006935
GO:0016301
AF-A0A7V4EM72-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.9793 2 124 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A534PI46-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.9791 2 117 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A7V0ULA9-F1-model_v4 Response regulator 0.9761 2 121 GO:0000160
AF-A0A661UAC1-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.976 2 123 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565

Map