F249352

General Info

Members Datasets Scaffolds Average Seq Length
166 115 332 282

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_218699_c1|nmdc:mga06r32_218699_c1_953_1852
Length 299
Sequence MEIDRPSIVTFTPMNNRTLLLGAVAYDPKVVTIWEGFKAWFHKRDLAFDYILYSNYERQVEAHLAGHFHIAWNSPLAWVRAARMARVAGRRAEAVAMRDTDQNLTSVIVIRSDSPIKSVADLRGKRVGVGAIDSPQATLLPLSHLRANGAAPFADFYVARHDLLSGKHGDHIGGEREAARALIAGAVDAACMIDSNHLLFINEGTLPAGATRALAQTAPYDHCNFTAFDDAPRDLMNRFRELLLGMSYDDPEVRPLLDLEGLKAWRPGRVDGYRALERAVEEMKFYDDHGNIAVADYRY

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
64 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
65 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
73 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
79 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
80 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
81 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
82 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
83 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
84 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
85 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
86 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
92 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
93 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
102 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
110 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
112 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
115 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.22
Rhizosphere 87.95
Stem 0
Stem Tuber 0
Unclassified 4.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_218699_c1 3300050510 Bacteria 1893
2 JGI25407J50210_10010352 3300003373 Bacteria 2372
3 Ga0065707_10082923 3300005295 Bacteria 11399
4 Ga0070690_100067089 3300005330 Bacteria 2324
5 Ga0070670_100260376 3300005331 Bacteria 1512
6 Ga0070689_100058133 3300005340 Bacteria 3003
7 Ga0070669_100111419 3300005353 Bacteria 2077
8 Ga0070673_100223096 3300005364 Bacteria 1632
9 Ga0070700_100051978 3300005441 Bacteria 2553
10 Ga0070708_100299080 3300005445 Unclassified 1515
11 Ga0070685_10125360 3300005466 Bacteria 1599
12 Ga0070706_100060359 3300005467 Bacteria 3500
13 Ga0070706_100694095 3300005467 Bacteria 944
14 Ga0070707_100003992 3300005468 Bacteria 13888
15 Ga0070698_100011789 3300005471 Bacteria 9275
16 Ga0070698_100042195 3300005471 Bacteria 4679
17 Ga0070698_100257646 3300005471 Bacteria 1677
18 Ga0070699_100000020 3300005518 Bacteria 182025
19 Ga0070699_100004758 3300005518 Bacteria 12000
20 Ga0070699_100188953 3300005518 Bacteria 1829
21 Ga0070697_100053141 3300005536 Bacteria 3292
22 Ga0070697_100419208 3300005536 Bacteria 1163
23 Ga0070672_100174125 3300005543 Bacteria 1791
24 Ga0070665_100098330 3300005548 Bacteria 2931
25 Ga0068859_100008800 3300005617 Bacteria 10192
26 Ga0068859_100241197 3300005617 Bacteria 1897
27 Ga0068864_100210242 3300005618 Bacteria 1791
28 Ga0068863_100107889 3300005841 Bacteria 2650
29 Ga0068863_100459533 3300005841 Bacteria 1250
30 Ga0068860_100358984 3300005843 Bacteria 1435
31 Ga0081455_10000635 3300005937 Bacteria 45562
32 Ga0081455_10009897 3300005937 Bacteria 9756
33 Ga0081455_10020211 3300005937 Bacteria 6278
34 Ga0081538_10001780 3300005981 Bacteria 21747
35 Ga0081538_10002303 3300005981 Bacteria 18874
36 Ga0081538_10002472 3300005981 Bacteria 18043
37 Ga0081538_10010709 3300005981 Bacteria 7504
38 Ga0081538_10012694 3300005981 Bacteria 6736
39 Ga0070717_10001088 3300006028 Bacteria 18276
40 Ga0070717_10033611 3300006028 Bacteria 4138
41 Ga0075428_100087465 3300006844 Bacteria 3399
42 Ga0075430_100143578 3300006846 Bacteria 1988
43 Ga0075431_100002226 3300006847 Bacteria 18568
44 Ga0075431_100165223 3300006847 Bacteria 2275
45 Ga0075431_100315359 3300006847 Bacteria 1578
46 Ga0075433_10234396 3300006852 Unclassified 1629
47 Ga0075433_10238463 3300006852 Bacteria 1614
48 Ga0075433_10424709 3300006852 Bacteria 1172
49 Ga0075434_100014300 3300006871 Bacteria 7584
50 Ga0075434_100252741 3300006871 Bacteria 1782
51 Ga0075429_100262318 3300006880 Bacteria 1513
52 Ga0075429_100378870 3300006880 Bacteria 1239
53 Ga0097620_100008800 3300006931 Bacteria 10192
54 Ga0097620_100241184 3300006931 Bacteria 1897
55 Ga0075435_100058409 3300007076 Bacteria 3124
56 Ga0075435_100125927 3300007076 Bacteria 2141
57 Ga0111539_10255661 3300009094 Bacteria 2040
58 Ga0105247_10020138 3300009101 Bacteria 4010
59 Ga0114129_10034577 3300009147 Bacteria 7140
60 Ga0114129_10097314 3300009147 Bacteria 4074
61 Ga0114129_10114232 3300009147 Bacteria 3723
62 Ga0114129_10411447 3300009147 Bacteria 1781
63 Ga0105249_10636062 3300009553 Bacteria 1124
64 Ga0157375_10060869 3300013308 Bacteria 3746
65 Ga0163163_10010262 3300014325 Bacteria 8414
66 Ga0157379_10095125 3300014968 Bacteria 2673
67 Ga0157379_10224555 3300014968 Bacteria 1702
68 Ga0213873_10025410 3300021358 Bacteria 1429
69 Ga0213876_10029569 3300021384 Bacteria 2887
70 Ga0213875_10000873 3300021388 Bacteria 22148
71 Ga0213875_10010655 3300021388 Bacteria 4601
72 Ga0207710_10035897 3300025900 Bacteria 2183
73 Ga0207684_10004392 3300025910 Bacteria 13294
74 Ga0207684_10088780 3300025910 Bacteria 2634
75 Ga0207684_10551519 3300025910 Bacteria 986
76 Ga0207646_10001798 3300025922 Bacteria 25930
77 Ga0207670_10039602 3300025936 Bacteria 3088
78 Ga0207691_10195317 3300025940 Bacteria 1763
79 Ga0207689_10076436 3300025942 Bacteria 2753
80 Ga0207708_10222055 3300026075 Bacteria 1514
81 Ga0207641_10095326 3300026088 Bacteria 2612
82 Ga0207676_10157671 3300026095 Bacteria 1963
83 Ga0207428_10206877 3300027907 Bacteria 1476
84 Ga0268264_10095925 3300028381 Bacteria 2567
85 Ga0268264_10250567 3300028381 Bacteria 1645
86 Ga0265337_1002060 3300028556 Bacteria 9511
87 Ga0265320_10000371 3300031240 Bacteria 36424
88 Ga0265331_10023251 3300031250 Bacteria 3151
89 Ga0307513_10002419 3300031456 Bacteria 25865
90 Ga0265314_10180120 3300031711 Bacteria 1267
91 Ga0307516_10131735 3300031730 Bacteria 2279
92 Ga0307413_10520769 3300031824 Bacteria 959
93 Ga0307415_100145949 3300032126 Bacteria 1814
94 Ga0373927_0013714 3300035695 Bacteria 5381
95 Ga0373947_0064881 3300035725 Bacteria 2227
96 Ga0373925_0030687 3300037068 Bacteria 3946
97 Ga0395899_0125990 3300037312 Bacteria 1832
98 Ga0395905_0180131 3300037471 Bacteria 1984
99 Ga0436364_0340628 3300037853 Bacteria 1492
100 Ga0436364_0524121 3300037853 Bacteria 5176
101 Ga0436364_0947140 3300037853 Bacteria 3775
102 Ga0436365_1281731 3300039437 Bacteria 5233
103 Ga0436365_1928292 3300039437 Bacteria 7841
104 Ga0436360_0240396 3300039438 Bacteria 1187
105 Ga0436363_0846120 3300039450 Unclassified 4692
106 Ga0436362_0486898 3300039453 Unclassified 2321
107 Ga0436362_1302257 3300039453 Bacteria 6488
108 Ga0451833_0425747 3300041491 Bacteria 1024
109 Ga0495603_0070423 3300046455 Bacteria 2056
110 Ga0495629_0109920 3300046459 Bacteria 1922
111 Ga0495638_0005358 3300046460 Bacteria 9564
112 Ga0495641_0011802 3300046461 Bacteria 4940
113 Ga0495582_0054862 3300046473 Bacteria 2197
114 Ga0495639_0007538 3300046475 Bacteria 4674
115 Ga0495639_0030726 3300046475 Bacteria 2388
116 Ga0495639_0083263 3300046475 Bacteria 1492
117 Ga0495594_0003211 3300046499 Bacteria 8469
118 Ga0495586_0103778 3300046535 Bacteria 1579
119 Ga0495634_0018552 3300046642 Bacteria 4951
120 Ga0495625_0002000 3300046660 Bacteria 23015
121 Ga0495635_0000581 3300046663 Bacteria 23469
122 Ga0495635_0167198 3300046663 Bacteria 1496
123 Ga0495647_0011088 3300046681 Bacteria 3081
124 Ga0495647_0014411 3300046681 Bacteria 2754
125 Ga0495658_0000783 3300046683 Bacteria 17143
126 Ga0495658_0014360 3300046683 Bacteria 4047
127 Ga0495613_0003736 3300046689 Bacteria 11409
128 Ga0495581_0009289 3300047315 Bacteria 5691
129 Ga0495676_0026022 3300047321 Bacteria 5042
130 Ga0495680_0000112 3300047322 Bacteria 76570
131 Ga0495680_0038360 3300047322 Bacteria 3829
132 Ga0495680_0318308 3300047322 Bacteria 1089
133 Ga0495684_0407842 3300047471 Bacteria 952
134 Ga0495593_0028882 3300047673 Bacteria 3045
135 Ga0495614_0004784 3300048089 Bacteria 6110
136 Ga0496102_0245728 3300048905 Bacteria 1687
137 Ga0496104_0189951 3300048907 Bacteria 1965
138 Ga0496105_0054351 3300048908 Bacteria 3306
139 Ga0496108_0109146 3300048911 Bacteria 2364
140 Ga0496109_0000198 3300048912 Bacteria 59776
141 Ga0496109_0012337 3300048912 Bacteria 7377
142 Ga0496110_0001555 3300048913 Bacteria 16720
143 Ga0501047_0145731 3300049581 Bacteria 2245
144 Ga0501071_0158012 3300049587 Bacteria 1693
145 Ga0501075_0018702 3300049591 Bacteria 5018
146 Ga0501079_0032775 3300049741 Bacteria 3996
147 Ga0501080_0359602 3300049742 Unclassified 1313
148 Ga0501081_0078764 3300049743 Unclassified 2304
149 nmdc:mga05p37_32291_c1 3300050507 Bacteria 6402
150 nmdc:mga05p37_4743_c2 3300050507 Bacteria 5796
151 nmdc:mga05p37_633159_c1 3300050507 Bacteria 1201
152 nmdc:mga05p37_64616_c2 3300050507 Bacteria 4042
153 nmdc:mga09592_183824_c1 3300050508 Bacteria 1808
154 nmdc:mga06r32_2213_c1 3300050510 Bacteria 17409
155 nmdc:mga06r32_254237_c1 3300050510 Bacteria 1745
156 nmdc:mga06r32_694947_c1 3300050510 Bacteria 983
157 nmdc:mga0n895_179166_c1 3300050512 Bacteria 2150
158 nmdc:mga0n895_36598_c1 3300050512 Bacteria 4740
159 nmdc:mga0rr50_115246_c2 3300050513 Bacteria 1756
160 nmdc:mga0rr50_372734_c1 3300050513 Bacteria 1203
161 nmdc:mga08x19_200398_c1 3300050514 Bacteria 1368
162 nmdc:mga0a205_8024_c1 3300050515 Bacteria 9595
163 Ga0495619_0047069 3300053085 Bacteria 2838
164 Ga0501084_0114944 3300054114 Unclassified 2262
165 2929222760 2929219909 Bacteria 6984360
166 8003831139 8003830390 Bacteria 6541657
167 nmdc:mga06r32_218699_c1
168 JGI25407J50210_10010352
169 Ga0065707_10082923
170 Ga0070690_100067089
171 Ga0070670_100260376
172 Ga0070689_100058133
173 Ga0070669_100111419
174 Ga0070673_100223096
175 Ga0070700_100051978
176 Ga0070708_100299080
177 Ga0070685_10125360
178 Ga0070706_100060359
179 Ga0070706_100694095
180 Ga0070707_100003992
181 Ga0070698_100011789
182 Ga0070698_100042195
183 Ga0070698_100257646
184 Ga0070699_100000020
185 Ga0070699_100004758
186 Ga0070699_100188953
187 Ga0070697_100053141
188 Ga0070697_100419208
189 Ga0070672_100174125
190 Ga0070665_100098330
191 Ga0068859_100008800
192 Ga0068859_100241197
193 Ga0068864_100210242
194 Ga0068863_100107889
195 Ga0068863_100459533
196 Ga0068860_100358984
197 Ga0081455_10000635
198 Ga0081455_10009897
199 Ga0081455_10020211
200 Ga0081538_10001780
201 Ga0081538_10002303
202 Ga0081538_10002472
203 Ga0081538_10010709
204 Ga0081538_10012694
205 Ga0070717_10001088
206 Ga0070717_10033611
207 Ga0075428_100087465
208 Ga0075430_100143578
209 Ga0075431_100002226
210 Ga0075431_100165223
211 Ga0075431_100315359
212 Ga0075433_10234396
213 Ga0075433_10238463
214 Ga0075433_10424709
215 Ga0075434_100014300
216 Ga0075434_100252741
217 Ga0075429_100262318
218 Ga0075429_100378870
219 Ga0097620_100008800
220 Ga0097620_100241184
221 Ga0075435_100058409
222 Ga0075435_100125927
223 Ga0111539_10255661
224 Ga0105247_10020138
225 Ga0114129_10034577
226 Ga0114129_10097314
227 Ga0114129_10114232
228 Ga0114129_10411447
229 Ga0105249_10636062
230 Ga0157375_10060869
231 Ga0163163_10010262
232 Ga0157379_10095125
233 Ga0157379_10224555
234 Ga0213873_10025410
235 Ga0213876_10029569
236 Ga0213875_10000873
237 Ga0213875_10010655
238 Ga0207710_10035897
239 Ga0207684_10004392
240 Ga0207684_10088780
241 Ga0207684_10551519
242 Ga0207646_10001798
243 Ga0207670_10039602
244 Ga0207691_10195317
245 Ga0207689_10076436
246 Ga0207708_10222055
247 Ga0207641_10095326
248 Ga0207676_10157671
249 Ga0207428_10206877
250 Ga0268264_10095925
251 Ga0268264_10250567
252 Ga0265337_1002060
253 Ga0265320_10000371
254 Ga0265331_10023251
255 Ga0307513_10002419
256 Ga0265314_10180120
257 Ga0307516_10131735
258 Ga0307413_10520769
259 Ga0307415_100145949
260 Ga0373927_0013714
261 Ga0373947_0064881
262 Ga0373925_0030687
263 Ga0395899_0125990
264 Ga0395905_0180131
265 Ga0436364_0340628
266 Ga0436364_0524121
267 Ga0436364_0947140
268 Ga0436365_1281731
269 Ga0436365_1928292
270 Ga0436360_0240396
271 Ga0436363_0846120
272 Ga0436362_0486898
273 Ga0436362_1302257
274 Ga0451833_0425747
275 Ga0495603_0070423
276 Ga0495629_0109920
277 Ga0495638_0005358
278 Ga0495641_0011802
279 Ga0495582_0054862
280 Ga0495639_0007538
281 Ga0495639_0030726
282 Ga0495639_0083263
283 Ga0495594_0003211
284 Ga0495586_0103778
285 Ga0495634_0018552
286 Ga0495625_0002000
287 Ga0495635_0000581
288 Ga0495635_0167198
289 Ga0495647_0011088
290 Ga0495647_0014411
291 Ga0495658_0000783
292 Ga0495658_0014360
293 Ga0495613_0003736
294 Ga0495581_0009289
295 Ga0495676_0026022
296 Ga0495680_0000112
297 Ga0495680_0038360
298 Ga0495680_0318308
299 Ga0495684_0407842
300 Ga0495593_0028882
301 Ga0495614_0004784
302 Ga0496102_0245728
303 Ga0496104_0189951
304 Ga0496105_0054351
305 Ga0496108_0109146
306 Ga0496109_0000198
307 Ga0496109_0012337
308 Ga0496110_0001555
309 Ga0501047_0145731
310 Ga0501071_0158012
311 Ga0501075_0018702
312 Ga0501079_0032775
313 Ga0501080_0359602
314 Ga0501081_0078764
315 nmdc:mga05p37_32291_c1
316 nmdc:mga05p37_4743_c2
317 nmdc:mga05p37_633159_c1
318 nmdc:mga05p37_64616_c2
319 nmdc:mga09592_183824_c1
320 nmdc:mga06r32_2213_c1
321 nmdc:mga06r32_254237_c1
322 nmdc:mga06r32_694947_c1
323 nmdc:mga0n895_179166_c1
324 nmdc:mga0n895_36598_c1
325 nmdc:mga0rr50_115246_c2
326 nmdc:mga0rr50_372734_c1
327 nmdc:mga08x19_200398_c1
328 nmdc:mga0a205_8024_c1
329 Ga0495619_0047069
330 Ga0501084_0114944
331 2929222760
332 8003831139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

24

273

0.86

PF09084

NMT1

NMT1/THI5 like

33

157

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ghq-assembly1.cif.gz_A htxb d206n protein variant from pseudomonas stutzeri in a partially open conformation to 1.53 a resolution 0.8315 1 272
6ghq-assembly1.cif.gz_A htxb d206n protein variant from pseudomonas stutzeri in a partially open conformation to 1.53 a resolution 0.8089 1 272
3tel-assembly1.cif.gz_A lytr-cps2a-psr family protein with bound octaprenyl pyrophosphate lipid and manganese ion 0.8007 91 206
2j3l-assembly1.cif.gz_A prolyl-trna synthetase from enterococcus faecalis complexed with a prolyl-adenylate analogue ('5'-o-(n-(l-prolyl)-sulfamoyl)adenosine) 0.7987 7 38
7plo-assembly1.cif.gz_C h. sapiens replisome-cul2/lrr1 complex 0.7965 5 53
ID Description Score Start End Superfamily
af_O33182_88_189_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9013 87 190 3.40.190.10
af_Q2G1L7_145_252_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8971 93 205 3.40.190.10
af_O33182_88_189_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8849 87 190 3.40.190.10
af_Q2G1L7_145_252_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8509 93 205 3.40.190.10
af_E7F2E3_357_433_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8417 7 59 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6J7Q3I0-F1-model_v4 Unannotated protein 0.9897 1 286
AF-A0A7X0CCG2-F1-model_v4 ABC-type phosphate/phosphonate transport system substrate-binding protein 0.9884 5 287
AF-A0A7X0CCG2-F1-model_v4 ABC-type phosphate/phosphonate transport system substrate-binding protein 0.985 5 287
AF-A0A521RG76-F1-model_v4 Phosphonate ABC transporter substrate-binding protein 0.983 5 273
AF-A0A6J7Q3I0-F1-model_v4 Unannotated protein 0.9829 1 286

Map