F249341

General Info

Members Datasets Scaffolds Average Seq Length
166 103 166 177

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_1067_c1|nmdc:mga05p37_1067_c1_8376_8996
Length 206
Sequence LSDNQDKTPPFYSIALWLRAIVVYILVAMNVEVTRTYLQLSRLEDLSSARIDDPRVRVERVEECPASFYRYLYAEVGRFYHWVDRLPWTDAEIRSHLTRTEISLWAMYCEGAPAGYFELERHPDGSIEIAYFGLMQEFLGRGLGRHLLTVAAEQAWSDQAKRVWLHTCTLDDVAAMPNYLKRGFKPFKQETYSTEITAEERLRAFD

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
57 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
58 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
59 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
60 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
61 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
65 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
66 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
67 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
68 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
69 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
70 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
71 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
72 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
73 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
82 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
85 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
86 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
87 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
90 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
91 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
92 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
93 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
94 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
95 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
96 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
97 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
98 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
99 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
100 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
101 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
103 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.02
Rhizosphere 93.37
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10184629 3300003322 Bacteria 2378
2 Ga0065707_10131902 3300005295 Bacteria 1906
3 Ga0070690_100043607 3300005330 Bacteria 2845
4 Ga0070673_101173079 3300005364 Bacteria 719
5 Ga0070709_10000021 3300005434 Bacteria 135637
6 Ga0070713_100135184 3300005436 Unclassified 2178
7 Ga0070705_100075197 3300005440 Bacteria 2056
8 Ga0070705_100093332 3300005440 Bacteria 1881
9 Ga0070694_100081047 3300005444 Bacteria 2257
10 Ga0070694_100795247 3300005444 Unclassified 775
11 Ga0070708_100021914 3300005445 Bacteria 5413
12 Ga0070708_100104049 3300005445 Bacteria 2603
13 Ga0070708_100428898 3300005445 Bacteria 1247
14 Ga0070708_100510469 3300005445 Bacteria 1134
15 Ga0070663_100280772 3300005455 Bacteria 1327
16 Ga0070681_10117914 3300005458 Bacteria 2591
17 Ga0070706_100150876 3300005467 Bacteria 2170
18 Ga0070706_100405992 3300005467 Bacteria 1268
19 Ga0070706_100573468 3300005467 Bacteria 1049
20 Ga0070707_100075417 3300005468 Bacteria 3253
21 Ga0070707_100466966 3300005468 Bacteria 1223
22 Ga0070699_100037385 3300005518 Bacteria 4201
23 Ga0070697_100012582 3300005536 Bacteria 6628
24 Ga0070695_100203181 3300005545 Bacteria 1417
25 Ga0070695_100460638 3300005545 Bacteria 976
26 Ga0070696_100000824 3300005546 Bacteria 19978
27 Ga0070696_100082235 3300005546 Bacteria 2283
28 Ga0070696_100657843 3300005546 Bacteria 850
29 Ga0070693_100711711 3300005547 Bacteria 736
30 Ga0070704_100022873 3300005549 Bacteria 4073
31 Ga0070704_100032244 3300005549 Unclassified 3532
32 Ga0070704_100078251 3300005549 Bacteria 2425
33 Ga0070704_100148525 3300005549 Bacteria 1840
34 Ga0070704_100736898 3300005549 Unclassified 876
35 Ga0068857_100162770 3300005577 Bacteria 2025
36 Ga0068857_100552171 3300005577 Bacteria 1085
37 Ga0068859_100704985 3300005617 Unclassified 1100
38 Ga0068864_100223862 3300005618 Bacteria 1737
39 Ga0068861_100038882 3300005719 Bacteria 3548
40 Ga0068870_10282418 3300005840 Bacteria 1041
41 Ga0068863_100750223 3300005841 Unclassified 972
42 Ga0068863_101528030 3300005841 Unclassified 676
43 Ga0081539_10024088 3300005985 Bacteria 3962
44 Ga0070716_100208556 3300006173 Bacteria 1304
45 Ga0070716_100476397 3300006173 Bacteria 916
46 Ga0075431_100021683 3300006847 Bacteria 6569
47 Ga0075431_100687674 3300006847 Bacteria 1001
48 Ga0075433_10109309 3300006852 Bacteria 2453
49 Ga0075433_10276464 3300006852 Bacteria 1488
50 Ga0075433_10452228 3300006852 Bacteria 1132
51 Ga0075434_100103887 3300006871 Bacteria 2850
52 Ga0075434_100330782 3300006871 Bacteria 1544
53 Ga0075434_100392463 3300006871 Unclassified 1409
54 Ga0075434_100545508 3300006871 Unclassified 1179
55 Ga0075434_100931990 3300006871 Unclassified 883
56 Ga0075429_100027845 3300006880 Bacteria 4906
57 Ga0075429_100036635 3300006880 Bacteria 4268
58 Ga0075436_100210410 3300006914 Unclassified 1378
59 Ga0097620_100705025 3300006931 Unclassified 1100
60 Ga0075435_100244012 3300007076 Bacteria 1528
61 Ga0111539_10009238 3300009094 Bacteria 12461
62 Ga0111539_10042836 3300009094 Bacteria 5432
63 Ga0114129_10050282 3300009147 Bacteria 5855
64 Ga0114129_10070930 3300009147 Bacteria 4858
65 Ga0114129_10098310 3300009147 Bacteria 4051
66 Ga0114129_10409261 3300009147 Bacteria 1786
67 Ga0114129_10624754 3300009147 Bacteria 1393
68 Ga0114129_10695161 3300009147 Bacteria 1308
69 Ga0114129_10969570 3300009147 Unclassified 1073
70 Ga0105241_10074503 3300009174 Bacteria 2643
71 Ga0105248_10123980 3300009177 Bacteria 2914
72 Ga0105248_10192192 3300009177 Bacteria 2300
73 Ga0105239_12472826 3300010375 Bacteria 605
74 Ga0163163_10466962 3300014325 Bacteria 1323
75 Ga0157380_10047979 3300014326 Bacteria 3361
76 Ga0157380_10491525 3300014326 Bacteria 1190
77 Ga0207653_10162823 3300025885 Bacteria 827
78 Ga0207699_10000005 3300025906 Bacteria 534560
79 Ga0207684_10044468 3300025910 Bacteria 3766
80 Ga0207684_10384739 3300025910 Bacteria 1206
81 Ga0207684_10558762 3300025910 Bacteria 979
82 Ga0207707_10134629 3300025912 Bacteria 2161
83 Ga0207646_10124720 3300025922 Bacteria 2315
84 Ga0207646_10168422 3300025922 Bacteria 1978
85 Ga0207700_10170988 3300025928 Unclassified 1813
86 Ga0207665_10031722 3300025939 Unclassified 3497
87 Ga0207711_10496428 3300025941 Unclassified 1137
88 Ga0207676_10105285 3300026095 Bacteria 2348
89 Ga0207676_10810172 3300026095 Unclassified 914
90 Ga0207675_100064876 3300026118 Bacteria 3413
91 Ga0268265_11869008 3300028380 Bacteria 607
92 Ga0265338_10079899 3300028800 Unclassified 2750
93 Ga0307416_100101275 3300032002 Bacteria 2508
94 Ga0307414_11142455 3300032004 Unclassified 720
95 Ga0373959_0006105 3300034820 Bacteria 1991
96 Ga0373951_0115637 3300035091 Bacteria 726
97 Ga0373941_0246952 3300035115 Bacteria 695
98 Ga0373962_0034444 3300035242 Bacteria 1403
99 Ga0373931_0150709 3300035691 Bacteria 1355
100 Ga0439446_0096437 3300042156 Unclassified 931
101 Ga0451576_0992844 3300045051 Unclassified 880
102 Ga0466967_0930867 3300045976 Bacteria 865
103 Ga0495580_0229703 3300046472 Bacteria 1274
104 Ga0496100_0394662 3300048903 Bacteria 1053
105 Ga0496102_0813868 3300048905 Bacteria 856
106 Ga0496104_0094361 3300048907 Bacteria 2862
107 Ga0496106_0176473 3300048909 Bacteria 1695
108 Ga0496106_0335936 3300048909 Unclassified 1213
109 Ga0496108_0023609 3300048911 Bacteria 5061
110 Ga0496109_0000316 3300048912 Bacteria 45455
111 Ga0496110_0012512 3300048913 Bacteria 6978
112 Ga0496112_0000406 3300048915 Bacteria 28243
113 Ga0496112_1482482 3300048915 Bacteria 592
114 Ga0501031_0099143 3300049568 Bacteria 1901
115 Ga0501031_0772914 3300049568 Bacteria 616
116 Ga0501036_0141240 3300049572 Bacteria 2032
117 Ga0501038_0097955 3300049574 Bacteria 2446
118 Ga0501040_0095828 3300049576 Bacteria 2065
119 Ga0501042_0020841 3300049578 Bacteria 4564
120 Ga0501042_0078250 3300049578 Bacteria 2368
121 Ga0501043_0896478 3300049579 Bacteria 636
122 Ga0501043_1105048 3300049579 Bacteria 560
123 Ga0501046_0121700 3300049580 Bacteria 1985
124 Ga0501048_0056629 3300049582 Bacteria 2781
125 Ga0501067_0094466 3300049583 Bacteria 1660
126 Ga0501070_0096488 3300049586 Bacteria 2446
127 Ga0501071_0079980 3300049587 Bacteria 2390
128 Ga0501072_0043814 3300049588 Bacteria 3518
129 Ga0501072_0134067 3300049588 Bacteria 1975
130 Ga0501075_0037952 3300049591 Unclassified 3601
131 Ga0501075_0816021 3300049591 Unclassified 710
132 Ga0501076_0150382 3300049592 Bacteria 1894
133 Ga0501079_0024145 3300049741 Unclassified 4666
134 Ga0501079_0109364 3300049741 Bacteria 2147
135 Ga0501079_0468589 3300049741 Bacteria 990
136 Ga0501080_0721446 3300049742 Unclassified 878
137 Ga0501081_0031122 3300049743 Bacteria 3616
138 Ga0501081_0143977 3300049743 Bacteria 1709
139 Ga0501081_1236593 3300049743 Bacteria 566
140 Ga0501083_0148340 3300049744 Bacteria 1536
141 Ga0501045_0121837 3300049824 Bacteria 1936
142 nmdc:mga05p37_1067_c1 3300050507 Bacteria 31379
143 nmdc:mga05p37_184561_c1 3300050507 Bacteria 2536
144 nmdc:mga05p37_37890_c1 3300050507 Bacteria 5913
145 nmdc:mga05p37_752935_c1 3300050507 Unclassified 1073
146 nmdc:mga09592_21072_c1 3300050508 Bacteria 5368
147 nmdc:mga09592_46565_c1 3300050508 Unclassified 3653
148 nmdc:mga0qj67_809131_c1 3300050509 Bacteria 741
149 nmdc:mga06r32_3031_c1 3300050510 Bacteria 15052
150 nmdc:mga06r32_906968_c1 3300050510 Unclassified 837
151 nmdc:mga08y16_27704_c1 3300050511 Bacteria 5970
152 nmdc:mga0n895_247504_c1 3300050512 Unclassified 1809
153 nmdc:mga0n895_569669_c1 3300050512 Unclassified 1137
154 nmdc:mga0rr50_16347_c1 3300050513 Bacteria 4443
155 nmdc:mga08x19_369027_c1 3300050514 Bacteria 1004
156 nmdc:mga08x19_46147_c1 3300050514 Bacteria 2786
157 nmdc:mga0a205_199585_c1 3300050515 Bacteria 1891
158 nmdc:mga0a205_291711_c1 3300050515 Bacteria 1505
159 nmdc:mga0a205_359158_c1 3300050515 Unclassified 1323
160 nmdc:mga0a205_396031_c1 3300050515 Bacteria 1245
161 nmdc:mga0a205_64240_c1 3300050515 Bacteria 3545
162 Ga0501084_0035547 3300054114 Bacteria 4165
163 Ga0501084_0394462 3300054114 Bacteria 1170
164 Ga0501082_0024319 3300060353 Bacteria 5222
165 Ga0501082_0281666 3300060353 Bacteria 1447
166 Ga0530510_0123105 3300061734 Bacteria 1905

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_100931990 Ga0075434_1009319902 148
2 3300048903 Ga0496100_0394662 Ga0496100_0394662_537_1043 155
3 3300048905 Ga0496102_0813868 Ga0496102_0813868_19_525 155
4 3300048909 Ga0496106_0335936 Ga0496106_0335936_10_516 155
5 3300048915 Ga0496112_1482482 Ga0496112_1482482_10_516 155
6 3300049579 Ga0501043_0896478 Ga0501043_0896478_35_568 160
7 3300049591 Ga0501075_0816021 Ga0501075_0816021_184_687 160
8 3300005841 Ga0068863_100750223 Ga0068863_1007502232 161
9 3300034820 Ga0373959_0006105 Ga0373959_0006105_121_627 161
10 3300035091 Ga0373951_0115637 Ga0373951_0115637_100_606 161
11 3300035115 Ga0373941_0246952 Ga0373941_0246952_28_534 161
12 3300035691 Ga0373931_0150709 Ga0373931_0150709_634_1140 161
13 3300048909 Ga0496106_0176473 Ga0496106_0176473_404_910 161
14 3300050514 nmdc:mga08x19_369027_c1 nmdc:mga08x19_369027_c1_37_543 161
15 3300049579 Ga0501043_1105048 Ga0501043_1105048_22_546 162
16 3300045051 Ga0451576_0992844 Ga0451576_0992844_325_840 163
17 3300005455 Ga0070663_100280772 Ga0070663_1002807721 164
18 3300005549 Ga0070704_100022873 Ga0070704_1000228732 167
19 3300005840 Ga0068870_10282418 Ga0068870_102824181 167
20 3300005444 Ga0070694_100795247 Ga0070694_1007952471 168
21 3300005445 Ga0070708_100510469 Ga0070708_1005104691 168
22 3300005546 Ga0070696_100082235 Ga0070696_1000822352 168
23 3300005546 Ga0070696_100657843 Ga0070696_1006578431 168
24 3300006852 Ga0075433_10109309 Ga0075433_101093093 168
25 3300006871 Ga0075434_100330782 Ga0075434_1003307822 168
26 3300006871 Ga0075434_100545508 Ga0075434_1005455082 168
27 3300014325 Ga0163163_10466962 Ga0163163_104669622 168
28 3300025910 Ga0207684_10558762 Ga0207684_105587622 168
29 3300025922 Ga0207646_10168422 Ga0207646_101684222 168
30 3300026095 Ga0207676_10105285 Ga0207676_101052853 168
31 3300032002 Ga0307416_100101275 Ga0307416_1001012753 168
32 3300035242 Ga0373962_0034444 Ga0373962_0034444_327_833 168
33 3300046472 Ga0495580_0229703 Ga0495580_0229703_633_1139 168
34 3300048907 Ga0496104_0094361 Ga0496104_0094361_1179_1685 168
35 3300048911 Ga0496108_0023609 Ga0496108_0023609_1121_1627 168
36 3300048912 Ga0496109_0000316 Ga0496109_0000316_26996_27502 168
37 3300048913 Ga0496110_0012512 Ga0496110_0012512_3370_3876 168
38 3300048915 Ga0496112_0000406 Ga0496112_0000406_24783_25289 168
39 3300049583 Ga0501067_0094466 Ga0501067_0094466_118_624 168
40 3300050515 nmdc:mga0a205_64240_c1 nmdc:mga0a205_64240_c1_1300_1806 168
41 3300061734 Ga0530510_0123105 Ga0530510_0123105_531_1037 168
42 3300005445 Ga0070708_100428898 Ga0070708_1004288982 169
43 3300005468 Ga0070707_100466966 Ga0070707_1004669663 169
44 3300005545 Ga0070695_100203181 Ga0070695_1002031812 169
45 3300006880 Ga0075429_100027845 Ga0075429_1000278456 170
46 3300009147 Ga0114129_10050282 Ga0114129_100502822 170
47 3300050507 nmdc:mga05p37_37890_c1 nmdc:mga05p37_37890_c1_2634_3161 170
48 3300050508 nmdc:mga09592_21072_c1 nmdc:mga09592_21072_c1_532_1044 170
49 3300005295 Ga0065707_10131902 Ga0065707_101319022 171
50 3300005364 Ga0070673_101173079 Ga0070673_1011730791 171
51 3300005434 Ga0070709_10000021 Ga0070709_1000002162 171
52 3300005436 Ga0070713_100135184 Ga0070713_1001351842 171
53 3300005444 Ga0070694_100081047 Ga0070694_1000810471 171
54 3300005445 Ga0070708_100021914 Ga0070708_1000219142 171
55 3300005467 Ga0070706_100405992 Ga0070706_1004059921 171
56 3300005467 Ga0070706_100573468 Ga0070706_1005734681 171
57 3300005468 Ga0070707_100075417 Ga0070707_1000754172 171
58 3300005545 Ga0070695_100460638 Ga0070695_1004606381 171
59 3300005549 Ga0070704_100078251 Ga0070704_1000782512 171
60 3300005549 Ga0070704_100736898 Ga0070704_1007368981 171
61 3300005577 Ga0068857_100162770 Ga0068857_1001627702 171
62 3300005577 Ga0068857_100552171 Ga0068857_1005521712 171
63 3300005618 Ga0068864_100223862 Ga0068864_1002238622 171
64 3300005719 Ga0068861_100038882 Ga0068861_1000388823 171
65 3300005841 Ga0068863_101528030 Ga0068863_1015280301 171
66 3300006173 Ga0070716_100476397 Ga0070716_1004763971 171
67 3300006847 Ga0075431_100021683 Ga0075431_1000216834 171
68 3300006852 Ga0075433_10276464 Ga0075433_102764642 171
69 3300006852 Ga0075433_10452228 Ga0075433_104522282 171
70 3300006880 Ga0075429_100036635 Ga0075429_1000366352 171
71 3300006914 Ga0075436_100210410 Ga0075436_1002104101 171
72 3300007076 Ga0075435_100244012 Ga0075435_1002440121 171
73 3300009094 Ga0111539_10009238 Ga0111539_1000923812 171
74 3300009094 Ga0111539_10042836 Ga0111539_100428364 171
75 3300009147 Ga0114129_10070930 Ga0114129_100709304 171
76 3300009147 Ga0114129_10098310 Ga0114129_100983105 171
77 3300009147 Ga0114129_10969570 Ga0114129_109695701 171
78 3300009177 Ga0105248_10123980 Ga0105248_101239802 171
79 3300014326 Ga0157380_10047979 Ga0157380_100479793 171
80 3300014326 Ga0157380_10491525 Ga0157380_104915252 171
81 3300025906 Ga0207699_10000005 Ga0207699_10000005133 171
82 3300025910 Ga0207684_10044468 Ga0207684_100444682 171
83 3300025910 Ga0207684_10384739 Ga0207684_103847392 171
84 3300025922 Ga0207646_10124720 Ga0207646_101247202 171
85 3300025928 Ga0207700_10170988 Ga0207700_101709882 171
86 3300025939 Ga0207665_10031722 Ga0207665_100317223 171
87 3300025941 Ga0207711_10496428 Ga0207711_104964281 171
88 3300026095 Ga0207676_10810172 Ga0207676_108101721 171
89 3300026118 Ga0207675_100064876 Ga0207675_1000648763 171
90 3300028800 Ga0265338_10079899 Ga0265338_100798991 171
91 3300045976 Ga0466967_0930867 Ga0466967_0930867_219_734 171
92 3300050507 nmdc:mga05p37_184561_c1 nmdc:mga05p37_184561_c1_281_859 171
93 3300050507 nmdc:mga05p37_752935_c1 nmdc:mga05p37_752935_c1_105_674 171
94 3300050508 nmdc:mga09592_46565_c1 nmdc:mga09592_46565_c1_829_1380 171
95 3300050510 nmdc:mga06r32_3031_c1 nmdc:mga06r32_3031_c1_2587_3111 171
96 3300050510 nmdc:mga06r32_906968_c1 nmdc:mga06r32_906968_c1_69_620 171
97 3300050511 nmdc:mga08y16_27704_c1 nmdc:mga08y16_27704_c1_4554_5069 171
98 3300050512 nmdc:mga0n895_247504_c1 nmdc:mga0n895_247504_c1_757_1281 171
99 3300050513 nmdc:mga0rr50_16347_c1 nmdc:mga0rr50_16347_c1_902_1453 171
100 3300050514 nmdc:mga08x19_46147_c1 nmdc:mga08x19_46147_c1_123_668 171
101 3300050515 nmdc:mga0a205_291711_c1 nmdc:mga0a205_291711_c1_486_1022 171
102 3300050515 nmdc:mga0a205_359158_c1 nmdc:mga0a205_359158_c1_598_1155 171
103 3300050515 nmdc:mga0a205_396031_c1 nmdc:mga0a205_396031_c1_165_710 171
104 3300003322 rootL2_10184629 rootL2_101846292 172
105 3300005330 Ga0070690_100043607 Ga0070690_1000436072 172
106 3300005440 Ga0070705_100075197 Ga0070705_1000751971 172
107 3300005440 Ga0070705_100093332 Ga0070705_1000933323 172
108 3300005445 Ga0070708_100104049 Ga0070708_1001040492 172
109 3300005458 Ga0070681_10117914 Ga0070681_101179142 172
110 3300005467 Ga0070706_100150876 Ga0070706_1001508762 172
111 3300005518 Ga0070699_100037385 Ga0070699_1000373855 172
112 3300005536 Ga0070697_100012582 Ga0070697_1000125828 172
113 3300005546 Ga0070696_100000824 Ga0070696_10000082414 172
114 3300005547 Ga0070693_100711711 Ga0070693_1007117111 172
115 3300005549 Ga0070704_100032244 Ga0070704_1000322441 172
116 3300005549 Ga0070704_100148525 Ga0070704_1001485253 172
117 3300005617 Ga0068859_100704985 Ga0068859_1007049851 172
118 3300005985 Ga0081539_10024088 Ga0081539_100240884 172
119 3300006173 Ga0070716_100208556 Ga0070716_1002085562 172
120 3300006847 Ga0075431_100687674 Ga0075431_1006876741 172
121 3300006871 Ga0075434_100103887 Ga0075434_1001038873 172
122 3300006871 Ga0075434_100392463 Ga0075434_1003924632 172
123 3300006931 Ga0097620_100705025 Ga0097620_1007050252 172
124 3300009147 Ga0114129_10409261 Ga0114129_104092612 172
125 3300009147 Ga0114129_10624754 Ga0114129_106247541 172
126 3300009147 Ga0114129_10695161 Ga0114129_106951612 172
127 3300009174 Ga0105241_10074503 Ga0105241_100745032 172
128 3300009177 Ga0105248_10192192 Ga0105248_101921923 172
129 3300010375 Ga0105239_12472826 Ga0105239_124728261 172
130 3300025885 Ga0207653_10162823 Ga0207653_101628232 172
131 3300025912 Ga0207707_10134629 Ga0207707_101346293 172
132 3300028380 Ga0268265_11869008 Ga0268265_118690081 172
133 3300032004 Ga0307414_11142455 Ga0307414_111424551 172
134 3300042156 Ga0439446_0096437 Ga0439446_0096437_22_543 172
135 3300049568 Ga0501031_0099143 Ga0501031_0099143_810_1379 172
136 3300049568 Ga0501031_0772914 Ga0501031_0772914_34_591 172
137 3300049572 Ga0501036_0141240 Ga0501036_0141240_860_1429 172
138 3300049574 Ga0501038_0097955 Ga0501038_0097955_988_1545 172
139 3300049576 Ga0501040_0095828 Ga0501040_0095828_1199_1768 172
140 3300049578 Ga0501042_0020841 Ga0501042_0020841_1105_1674 172
141 3300049578 Ga0501042_0078250 Ga0501042_0078250_230_787 172
142 3300049580 Ga0501046_0121700 Ga0501046_0121700_1143_1712 172
143 3300049582 Ga0501048_0056629 Ga0501048_0056629_1977_2546 172
144 3300049586 Ga0501070_0096488 Ga0501070_0096488_995_1564 172
145 3300049587 Ga0501071_0079980 Ga0501071_0079980_774_1331 172
146 3300049588 Ga0501072_0043814 Ga0501072_0043814_41_610 172
147 3300049588 Ga0501072_0134067 Ga0501072_0134067_715_1272 172
148 3300049591 Ga0501075_0037952 Ga0501075_0037952_703_1260 172
149 3300049592 Ga0501076_0150382 Ga0501076_0150382_859_1428 172
150 3300049741 Ga0501079_0024145 Ga0501079_0024145_4026_4583 172
151 3300049741 Ga0501079_0109364 Ga0501079_0109364_1118_1687 172
152 3300049741 Ga0501079_0468589 Ga0501079_0468589_177_704 172
153 3300049742 Ga0501080_0721446 Ga0501080_0721446_240_767 172
154 3300049743 Ga0501081_0031122 Ga0501081_0031122_1041_1598 172
155 3300049743 Ga0501081_0143977 Ga0501081_0143977_247_816 172
156 3300049743 Ga0501081_1236593 Ga0501081_1236593_22_549 172
157 3300049744 Ga0501083_0148340 Ga0501083_0148340_260_793 172
158 3300049824 Ga0501045_0121837 Ga0501045_0121837_131_700 172
159 3300050507 nmdc:mga05p37_1067_c1 nmdc:mga05p37_1067_c1_8376_8996 172
160 3300050509 nmdc:mga0qj67_809131_c1 nmdc:mga0qj67_809131_c1_143_685 172
161 3300050512 nmdc:mga0n895_569669_c1 nmdc:mga0n895_569669_c1_270_800 172
162 3300050515 nmdc:mga0a205_199585_c1 nmdc:mga0a205_199585_c1_153_683 172
163 3300054114 Ga0501084_0035547 Ga0501084_0035547_1940_2497 172
164 3300054114 Ga0501084_0394462 Ga0501084_0394462_154_723 172
165 3300060353 Ga0501082_0024319 Ga0501082_0024319_1967_2524 172
166 3300060353 Ga0501082_0281666 Ga0501082_0281666_158_727 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

71

199

0.84

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

59

184

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yvk-assembly1.cif.gz_D crystal structure of the bacillis subtilis acetyltransferase in complex with coa, northeast structural genomics target sr237. 0.8307 28 158
7ypu-assembly4.cif.gz_H orfe-coa-glycylthricin complex 0.8264 74 158
7wx6-assembly1.cif.gz_A a legionella acetyltransferase vipf 0.8248 3 168
1y9k-assembly3.cif.gz_C iaa acetyltransferase from bacillus cereus atcc 14579 0.8199 28 161
3pp9-assembly2.cif.gz_B 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8177 67 158
ID Description Score Start End Superfamily
1y9kD01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8198 62 161 3.40.630.30
af_A0A0P0WGU7_189_301_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8191 74 161 3.40.630.30
af_A0A1D6G8A0_124_211_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8157 74 161 3.40.630.30
af_I1KF23_15_150_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8089 40 158 3.40.630.30
3d2pB02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8083 30 138 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2V8MYU8-F1-model_v4 GNAT family N-acetyltransferase 0.9776 2 167 GO:0016747
AF-A0A2D8G835-F1-model_v4 GNAT family N-acetyltransferase 0.976 28 109 GO:0016740
AF-A0A368N5S3-F1-model_v4 GNAT family N-acetyltransferase 0.9731 3 169 GO:0016747
AF-A0A1Q8BMP3-F1-model_v4 N-acetyltransferase domain-containing protein 0.9723 1 160 GO:0016747
AF-A0A7Y5PFD5-F1-model_v4 GNAT family N-acetyltransferase 0.97 2 167 GO:0016747

Feature Viewer

pLDDT pTM Quality
92.43 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map