F248961

General Info

Members Datasets Scaffolds Average Seq Length
166 76 166 418

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0031575|Ga0451576_0031575_3721_5154
Length 477
Sequence MLARTKLYQHQQRIGKRIIDHPPASSWQEGEKDFWGASGGWHRLKLPKPRKGLFEEGSILNIAMISYHTCPLAILGGKDTGGMNVYVRELTRYLGQRGVHVDVFTRSQDEHVPQILHDLGYGNRVVHVPAGPEHPLPKNELPSYLPQFVEGIQKFARDKGIHYDLIHSHYWMSGIAAEQLKESWGAPVVHMFHTLGQMKNRVAQSEAEMEGDYRIQGEYQVLEMADRIVAATPAEESQLQFLYHANQDKIVVIPPGVDISHFYPIPPDEAKSAIGVPEDECMLLFVGRIEPLKGVDTLMRAIAHMRTTGVTAQFPHYLAIIGGDPNVKTRQMNSEMARLQQLSRELGLEDLVVFLGKRLQSSLPYYYSAADVLIMPSHYESFGMVALEAMACGTPVVASQVGGLAFLIQDGVTGFVVPGGDPLALSERMTELLSQPELRRRLGGQAAAYAQEYSWEKIAGRIVELYQDVLAVTASTS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
29 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
33 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
34 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
35 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
36 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
37 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
38 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
39 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
40 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
41 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
42 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
43 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
44 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
45 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
47 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
48 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
49 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
50 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
51 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
52 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
53 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
54 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
55 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
56 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
57 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
58 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
59 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
63 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
64 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
65 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
66 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
67 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
68 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
69 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
70 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
71 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
72 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
73 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
74 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
75 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
76 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 1.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 96.99
Stem 0
Stem Tuber 0
Unclassified 3.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1076749 2162886007 Bacteria 13960
2 Ga0058860_10218809 3300004801 Unclassified 4222
3 Ga0065704_10000350 3300005289 Bacteria 28551
4 Ga0065707_10000485 3300005295 Bacteria 32743
5 Ga0065707_10089330 3300005295 Bacteria 4400
6 Ga0070700_100122579 3300005441 Bacteria 1744
7 Ga0070706_100187036 3300005467 Unclassified 1935
8 Ga0070698_100060593 3300005471 Bacteria 3819
9 Ga0070698_100117741 3300005471 Bacteria 2618
10 Ga0070698_100213289 3300005471 Bacteria 1865
11 Ga0070699_100052057 3300005518 Bacteria 3545
12 Ga0070704_100255209 3300005549 Bacteria 1442
13 Ga0068859_100102373 3300005617 Bacteria 2921
14 Ga0068859_100276028 3300005617 Bacteria 1773
15 Ga0068862_100033753 3300005844 Bacteria 4328
16 Ga0081455_10000246 3300005937 Bacteria 70584
17 Ga0081538_10000663 3300005981 Bacteria 38027
18 Ga0081538_10008547 3300005981 Bacteria 8668
19 Ga0081538_10010813 3300005981 Bacteria 7452
20 Ga0081540_1008518 3300005983 Bacteria 7159
21 Ga0081539_10001241 3300005985 Bacteria 45361
22 Ga0075427_10002893 3300006194 Bacteria 2332
23 Ga0075428_100003081 3300006844 Bacteria 18188
24 Ga0075428_100033917 3300006844 Bacteria 5631
25 Ga0075431_100012055 3300006847 Bacteria 8725
26 Ga0075431_100059523 3300006847 Unclassified 3942
27 Ga0075431_100065087 3300006847 Bacteria 3764
28 Ga0075431_100124618 3300006847 Bacteria 2659
29 Ga0075433_10055202 3300006852 Bacteria 3467
30 Ga0075429_100008653 3300006880 Bacteria 8851
31 Ga0075429_100049558 3300006880 Bacteria 3652
32 Ga0075429_100118456 3300006880 Bacteria 2314
33 Ga0097620_100102380 3300006931 Bacteria 2921
34 Ga0097620_100276015 3300006931 Bacteria 1773
35 Ga0111539_10042104 3300009094 Bacteria 5487
36 Ga0114129_10003970 3300009147 Bacteria 20892
37 Ga0114129_10039727 3300009147 Bacteria 6636
38 Ga0114129_10044068 3300009147 Bacteria 6276
39 Ga0114129_10047289 3300009147 Bacteria 6046
40 Ga0114129_10051964 3300009147 Bacteria 5752
41 Ga0114129_10132729 3300009147 Bacteria 3419
42 Ga0114129_10183439 3300009147 Bacteria 2846
43 Ga0114129_10190756 3300009147 Bacteria 2783
44 Ga0114129_10464580 3300009147 Bacteria 1658
45 Ga0105243_10068771 3300009148 Bacteria 2855
46 Ga0105249_10037279 3300009553 Bacteria 4413
47 Ga0105249_10092202 3300009553 Bacteria 2836
48 Ga0105246_10020052 3300011119 Bacteria 4285
49 Ga0163162_10242622 3300013306 Bacteria 1933
50 Ga0157380_10206510 3300014326 Bacteria 1747
51 Ga0207684_10150934 3300025910 Unclassified 1999
52 Ga0207660_10155389 3300025917 Bacteria 1761
53 Ga0207708_10200620 3300026075 Unclassified 1592
54 Ga0207428_10038125 3300027907 Unclassified 3908
55 Ga0265334_10005670 3300028573 Bacteria 5449
56 Ga0265338_10092447 3300028800 Bacteria 2495
57 Ga0265320_10073472 3300031240 Bacteria 1607
58 Ga0265327_10040434 3300031251 Bacteria 2522
59 Ga0316579_10003680 3300031691 Bacteria 6032
60 Ga0316576_10001561 3300031727 Bacteria 12431
61 Ga0316576_10003577 3300031727 Bacteria 9157
62 Ga0316576_10004113 3300031727 Bacteria 8679
63 Ga0316576_10022949 3300031727 Bacteria 4341
64 Ga0316578_10013141 3300031728 Unclassified 4380
65 Ga0316578_10028161 3300031728 Bacteria 3180
66 Ga0316578_10059593 3300031728 Bacteria 2246
67 Ga0316577_10017738 3300031733 Bacteria 3933
68 Ga0316577_10021435 3300031733 Bacteria 3585
69 Ga0316577_10022785 3300031733 Bacteria 3478
70 Ga0316577_10062073 3300031733 Unclassified 2087
71 Ga0316577_10078067 3300031733 Bacteria 1849
72 Ga0316577_10085719 3300031733 Bacteria 1763
73 Ga0316577_10088652 3300031733 Unclassified 1732
74 Ga0307413_10066260 3300031824 Bacteria 2253
75 Ga0307411_10108052 3300032005 Bacteria 1984
76 Ga0316585_10000125 3300032137 Bacteria 14588
77 Ga0316585_10010567 3300032137 Bacteria 2711
78 Ga0316585_10028959 3300032137 Bacteria 1734
79 Ga0316580_10000044 3300032139 Bacteria 19289
80 Ga0316596_1002093 3300033541 Bacteria 4209
81 Ga0373941_0036785 3300035115 Bacteria 1491
82 Ga0316574_0008296 3300035398 Bacteria 5761
83 Ga0316574_0013359 3300035398 Bacteria 4718
84 Ga0316582_0008668 3300036647 Bacteria 5474
85 Ga0316582_0016674 3300036647 Bacteria 4231
86 Ga0316582_0031978 3300036647 Bacteria 3220
87 Ga0316582_0056615 3300036647 Bacteria 2502
88 Ga0316582_0107849 3300036647 Bacteria 1851
89 Ga0316584_0004207 3300036712 Bacteria 9501
90 Ga0316584_0008803 3300036712 Bacteria 6972
91 Ga0316584_0011353 3300036712 Bacteria 6256
92 Ga0316584_0018857 3300036712 Bacteria 4981
93 Ga0316584_0031168 3300036712 Bacteria 3942
94 Ga0316584_0131592 3300036712 Bacteria 1868
95 Ga0316584_0262117 3300036712 Bacteria 1260
96 Ga0316581_0005958 3300037588 Unclassified 3205
97 Ga0316581_0009465 3300037588 Bacteria 2679
98 Ga0316581_0024950 3300037588 Unclassified 1776
99 Ga0400484_35305 3300038725 Unclassified 4190
100 Ga0400490_54751 3300038726 Bacteria 11185
101 Ga0400489_73415 3300039093 Bacteria 4740
102 Ga0400489_95230 3300039093 Bacteria 19686
103 Ga0451577_0097749 3300042876 Bacteria 2622
104 Ga0451577_0192797 3300042876 Bacteria 1838
105 Ga0453683_0000008 3300044673 Bacteria 542336
106 Ga0453683_0018647 3300044673 Bacteria 4454
107 Ga0453683_0028566 3300044673 Bacteria 3530
108 Ga0453683_0108783 3300044673 Bacteria 1743
109 Ga0453684_0000007 3300044712 Bacteria 1301482
110 Ga0453684_0000832 3300044712 Bacteria 104212
111 Ga0453684_0001196 3300044712 Bacteria 80161
112 Ga0453684_0001239 3300044712 Bacteria 77704
113 Ga0453684_0001406 3300044712 Bacteria 69468
114 Ga0453684_0004032 3300044712 Bacteria 31935
115 Ga0453684_0006493 3300044712 Bacteria 22190
116 Ga0453684_0020510 3300044712 Bacteria 9962
117 Ga0453684_0063182 3300044712 Bacteria 4738
118 Ga0453684_0103207 3300044712 Bacteria 3485
119 Ga0453684_0144485 3300044712 Bacteria 2836
120 Ga0453684_0160840 3300044712 Unclassified 2656
121 Ga0453684_0169126 3300044712 Bacteria 2578
122 Ga0453684_0265792 3300044712 Bacteria 1963
123 Ga0453684_0341773 3300044712 Bacteria 1690
124 Ga0453684_0370154 3300044712 Bacteria 1611
125 Ga0453684_0429329 3300044712 Bacteria 1474
126 Ga0451576_0000005 3300045051 Bacteria 1294643
127 Ga0451576_0000273 3300045051 Bacteria 126460
128 Ga0451576_0001888 3300045051 Bacteria 33668
129 Ga0451576_0031575 3300045051 Bacteria 5645
130 Ga0451576_0163422 3300045051 Bacteria 2323
131 Ga0451576_0433067 3300045051 Bacteria 1380
132 Ga0501298_003806 3300049521 Bacteria 2354
133 Ga0501317_000881 3300049533 Bacteria 2368
134 Ga0501040_0185846 3300049576 Bacteria 1474
135 Ga0501048_0041704 3300049582 Bacteria 3287
136 Ga0501071_0144354 3300049587 Bacteria 1774
137 Ga0501072_0205698 3300049588 Bacteria 1569
138 Ga0501074_0166104 3300049590 Bacteria 1576
139 Ga0501075_0031606 3300049591 Bacteria 3930
140 Ga0501075_0150994 3300049591 Bacteria 1771
141 Ga0501075_0269053 3300049591 Bacteria 1299
142 Ga0501076_0065274 3300049592 Bacteria 2902
143 Ga0501076_0093261 3300049592 Bacteria 2423
144 Ga0501079_0071202 3300049741 Bacteria 2686
145 Ga0501079_0142708 3300049741 Unclassified 1866
146 Ga0501080_0189428 3300049742 Bacteria 1891
147 Ga0501081_0005722 3300049743 Bacteria 8045
148 nmdc:mga05p37_116945_c1 3300050507 Bacteria 3277
149 nmdc:mga05p37_158522_c1 3300050507 Bacteria 2765
150 nmdc:mga05p37_27482_c1 3300050507 Bacteria 6926
151 nmdc:mga05p37_289_c1 3300050507 Bacteria 13387
152 nmdc:mga05p37_569736_c1 3300050507 Unclassified 1285
153 nmdc:mga05p37_68249_c1 3300050507 Bacteria 4373
154 nmdc:mga09592_176491_c1 3300050508 Bacteria 1848
155 nmdc:mga09592_22396_c1 3300050508 Bacteria 5214
156 nmdc:mga09592_255186_c1 3300050508 Bacteria 1520
157 nmdc:mga09592_27245_c1 3300050508 Bacteria 4742
158 nmdc:mga09592_312439_c1 3300050508 Unclassified 1362
159 nmdc:mga09592_52157_c1 3300050508 Bacteria 3452
160 nmdc:mga0qj67_134243_c1 3300050509 Bacteria 2005
161 nmdc:mga06r32_5640_c1 3300050510 Bacteria 11260
162 nmdc:mga06r32_8170_c1 3300050510 Bacteria 9415
163 nmdc:mga06r32_89845_c1 3300050510 Bacteria 3000
164 nmdc:mga0a205_102903_c1 3300050515 Bacteria 2754
165 Ga0501082_0265137 3300060353 Bacteria 1495
166 Ga0530510_0083668 3300061734 Viruses 2324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_569736_c1 nmdc:mga05p37_569736_c1_217_1275 343
2 3300050508 nmdc:mga09592_312439_c1 nmdc:mga09592_312439_c1_289_1347 343
3 3300044673 Ga0453683_0028566 Ga0453683_0028566_10_1107 357
4 3300049591 Ga0501075_0269053 Ga0501075_0269053_18_1130 370
5 3300009094 Ga0111539_10042104 Ga0111539_100421044 389
6 3300013306 Ga0163162_10242622 Ga0163162_102426222 389
7 3300014326 Ga0157380_10206510 Ga0157380_102065101 389
8 3300049533 Ga0501317_000881 Ga0501317_000881_752_1948 389
9 3300049576 Ga0501040_0185846 Ga0501040_0185846_41_1237 389
10 3300049587 Ga0501071_0144354 Ga0501071_0144354_120_1316 389
11 3300049588 Ga0501072_0205698 Ga0501072_0205698_44_1240 389
12 3300049590 Ga0501074_0166104 Ga0501074_0166104_247_1443 389
13 3300049742 Ga0501080_0189428 Ga0501080_0189428_89_1285 389
14 3300050507 nmdc:mga05p37_158522_c1 nmdc:mga05p37_158522_c1_1272_2468 389
15 3300050510 nmdc:mga06r32_8170_c1 nmdc:mga06r32_8170_c1_3756_4952 389
16 3300050509 nmdc:mga0qj67_134243_c1 nmdc:mga0qj67_134243_c1_798_1973 391
17 3300025917 Ga0207660_10155389 Ga0207660_101553892 392
18 3300036712 Ga0316584_0262117 Ga0316584_0262117_20_1204 392
19 3300045051 Ga0451576_0433067 Ga0451576_0433067_19_1197 392
20 3300036647 Ga0316582_0016674 Ga0316582_0016674_2967_4169 393
21 3300037588 Ga0316581_0024950 Ga0316581_0024950_536_1738 393
22 3300044712 Ga0453684_0063182 Ga0453684_0063182_2222_3412 393
23 3300038725 Ga0400484_35305 Ga0400484_35305_1702_3000 395
24 3300038726 Ga0400490_54751 Ga0400490_54751_185_1483 395
25 3300049741 Ga0501079_0142708 Ga0501079_0142708_239_1540 396
26 3300061734 Ga0530510_0083668 Ga0530510_0083668_244_1545 396
27 3300005981 Ga0081538_10008547 Ga0081538_100085477 401
28 3300035398 Ga0316574_0013359 Ga0316574_0013359_70_1314 401
29 3300036647 Ga0316582_0008668 Ga0316582_0008668_4077_5321 401
30 3300036712 Ga0316584_0008803 Ga0316584_0008803_3045_4289 401
31 3300037588 Ga0316581_0005958 Ga0316581_0005958_956_2200 401
32 3300044712 Ga0453684_0103207 Ga0453684_0103207_484_1725 404
33 3300036647 Ga0316582_0056615 Ga0316582_0056615_442_1671 405
34 3300044673 Ga0453683_0000008 Ga0453683_0000008_317730_318962 405
35 3300045051 Ga0451576_0000005 Ga0451576_0000005_1070037_1071269 405
36 3300005985 Ga0081539_10001241 Ga0081539_1000124117 406
37 3300028573 Ga0265334_10005670 Ga0265334_100056705 406
38 3300028800 Ga0265338_10092447 Ga0265338_100924474 406
39 3300042876 Ga0451577_0192797 Ga0451577_0192797_485_1708 406
40 3300044712 Ga0453684_0265792 Ga0453684_0265792_556_1821 406
41 3300005471 Ga0070698_100060593 Ga0070698_1000605933 407
42 3300006844 Ga0075428_100003081 Ga0075428_1000030812 408
43 3300006847 Ga0075431_100124618 Ga0075431_1001246182 408
44 3300009147 Ga0114129_10051964 Ga0114129_100519643 408
45 3300027907 Ga0207428_10038125 Ga0207428_100381253 408
46 3300044712 Ga0453684_0429329 Ga0453684_0429329_100_1335 408
47 3300050508 nmdc:mga09592_52157_c1 nmdc:mga09592_52157_c1_1228_2481 408
48 3300006880 Ga0075429_100008653 Ga0075429_1000086534 410
49 3300009553 Ga0105249_10037279 Ga0105249_100372794 410
50 3300031733 Ga0316577_10021435 Ga0316577_100214352 410
51 3300044673 Ga0453683_0018647 Ga0453683_0018647_993_2228 410
52 3300044712 Ga0453684_0000832 Ga0453684_0000832_71093_72328 410
53 3300005295 Ga0065707_10089330 Ga0065707_100893302 411
54 3300044712 Ga0453684_0001406 Ga0453684_0001406_67125_68363 411
55 3300044712 Ga0453684_0160840 Ga0453684_0160840_803_2041 411
56 3300005441 Ga0070700_100122579 Ga0070700_1001225791 412
57 3300005518 Ga0070699_100052057 Ga0070699_1000520574 412
58 3300005549 Ga0070704_100255209 Ga0070704_1002552091 412
59 3300005844 Ga0068862_100033753 Ga0068862_1000337535 412
60 3300006847 Ga0075431_100012055 Ga0075431_1000120555 412
61 3300006852 Ga0075433_10055202 Ga0075433_100552023 412
62 3300026075 Ga0207708_10200620 Ga0207708_102006202 412
63 3300035398 Ga0316574_0008296 Ga0316574_0008296_3201_4448 412
64 3300044712 Ga0453684_0004032 Ga0453684_0004032_3952_5199 412
65 3300049582 Ga0501048_0041704 Ga0501048_0041704_1815_3053 412
66 3300049592 Ga0501076_0065274 Ga0501076_0065274_253_1491 412
67 3300049741 Ga0501079_0071202 Ga0501079_0071202_1292_2530 412
68 3300050515 nmdc:mga0a205_102903_c1 nmdc:mga0a205_102903_c1_121_1359 412
69 3300006847 Ga0075431_100059523 Ga0075431_1000595233 413
70 3300011119 Ga0105246_10020052 Ga0105246_100200521 413
71 3300031727 Ga0316576_10003577 Ga0316576_100035772 413
72 3300031824 Ga0307413_10066260 Ga0307413_100662603 413
73 3300032005 Ga0307411_10108052 Ga0307411_101080522 413
74 3300036712 Ga0316584_0131592 Ga0316584_0131592_471_1784 413
75 3300044673 Ga0453683_0108783 Ga0453683_0108783_397_1638 413
76 3300044712 Ga0453684_0006493 Ga0453684_0006493_3833_5083 413
77 3300045051 Ga0451576_0163422 Ga0451576_0163422_306_1547 413
78 3300009147 Ga0114129_10039727 Ga0114129_100397277 414
79 3300031240 Ga0265320_10073472 Ga0265320_100734721 414
80 3300031733 Ga0316577_10085719 Ga0316577_100857191 414
81 3300044712 Ga0453684_0020510 Ga0453684_0020510_4103_5359 414
82 3300050507 nmdc:mga05p37_27482_c1 nmdc:mga05p37_27482_c1_2169_3413 414
83 3300005617 Ga0068859_100102373 Ga0068859_1001023731 415
84 3300006931 Ga0097620_100102380 Ga0097620_1001023801 415
85 3300009147 Ga0114129_10003970 Ga0114129_1000397010 415
86 3300031733 Ga0316577_10062073 Ga0316577_100620733 415
87 3300049521 Ga0501298_003806 Ga0501298_003806_900_2147 415
88 3300050507 nmdc:mga05p37_289_c1 nmdc:mga05p37_289_c1_10504_11751 415
89 3300050508 nmdc:mga09592_22396_c1 nmdc:mga09592_22396_c1_2541_3788 415
90 3300005617 Ga0068859_100276028 Ga0068859_1002760281 416
91 3300006931 Ga0097620_100276015 Ga0097620_1002760152 416
92 3300009147 Ga0114129_10183439 Ga0114129_101834393 416
93 3300009553 Ga0105249_10092202 Ga0105249_100922022 416
94 3300031691 Ga0316579_10003680 Ga0316579_100036801 416
95 3300031728 Ga0316578_10028161 Ga0316578_100281613 416
96 3300031733 Ga0316577_10022785 Ga0316577_100227852 416
97 3300031733 Ga0316577_10078067 Ga0316577_100780673 416
98 3300032137 Ga0316585_10028959 Ga0316585_100289592 416
99 3300036647 Ga0316582_0031978 Ga0316582_0031978_1056_2315 416
100 3300036712 Ga0316584_0011353 Ga0316584_0011353_2905_4164 416
101 3300036712 Ga0316584_0031168 Ga0316584_0031168_97_1371 416
102 3300044712 Ga0453684_0169126 Ga0453684_0169126_152_1411 416
103 3300044712 Ga0453684_0370154 Ga0453684_0370154_18_1316 416
104 3300050510 nmdc:mga06r32_5640_c1 nmdc:mga06r32_5640_c1_2321_3616 416
105 3300004801 Ga0058860_10218809 Ga0058860_102188094 417
106 3300005467 Ga0070706_100187036 Ga0070706_1001870361 417
107 3300005471 Ga0070698_100117741 Ga0070698_1001177412 417
108 3300005937 Ga0081455_10000246 Ga0081455_1000024641 417
109 3300005981 Ga0081538_10000663 Ga0081538_100006634 417
110 3300005983 Ga0081540_1008518 Ga0081540_10085183 417
111 3300006194 Ga0075427_10002893 Ga0075427_100028933 417
112 3300006844 Ga0075428_100033917 Ga0075428_1000339176 417
113 3300006847 Ga0075431_100065087 Ga0075431_1000650873 417
114 3300006880 Ga0075429_100049558 Ga0075429_1000495583 417
115 3300006880 Ga0075429_100118456 Ga0075429_1001184563 417
116 3300009147 Ga0114129_10044068 Ga0114129_100440689 417
117 3300009147 Ga0114129_10190756 Ga0114129_101907562 417
118 3300025910 Ga0207684_10150934 Ga0207684_101509341 417
119 3300042876 Ga0451577_0097749 Ga0451577_0097749_69_1334 417
120 3300044712 Ga0453684_0000007 Ga0453684_0000007_738306_739571 417
121 3300044712 Ga0453684_0144485 Ga0453684_0144485_643_1905 417
122 3300044712 Ga0453684_0341773 Ga0453684_0341773_212_1513 417
123 3300045051 Ga0451576_0000273 Ga0451576_0000273_46003_47280 417
124 3300045051 Ga0451576_0001888 Ga0451576_0001888_11349_12635 417
125 3300049591 Ga0501075_0150994 Ga0501075_0150994_191_1489 417
126 3300050507 nmdc:mga05p37_68249_c1 nmdc:mga05p37_68249_c1_716_1996 417
127 3300050508 nmdc:mga09592_27245_c1 nmdc:mga09592_27245_c1_1601_2857 417
128 3300050510 nmdc:mga06r32_89845_c1 nmdc:mga06r32_89845_c1_1391_2647 417
129 3300005289 Ga0065704_10000350 Ga0065704_1000035024 418
130 3300005295 Ga0065707_10000485 Ga0065707_1000048534 418
131 3300005471 Ga0070698_100213289 Ga0070698_1002132893 418
132 3300005981 Ga0081538_10010813 Ga0081538_100108138 418
133 3300009147 Ga0114129_10047289 Ga0114129_100472892 418
134 3300009147 Ga0114129_10132729 Ga0114129_101327292 418
135 3300009147 Ga0114129_10464580 Ga0114129_104645802 418
136 3300031251 Ga0265327_10040434 Ga0265327_100404342 418
137 3300031733 Ga0316577_10088652 Ga0316577_100886522 418
138 3300037588 Ga0316581_0009465 Ga0316581_0009465_1369_2625 418
139 3300039093 Ga0400489_73415 Ga0400489_73415_420_1706 418
140 3300049591 Ga0501075_0031606 Ga0501075_0031606_1631_2887 418
141 3300049592 Ga0501076_0093261 Ga0501076_0093261_984_2240 418
142 3300049743 Ga0501081_0005722 Ga0501081_0005722_4242_5498 418
143 3300050507 nmdc:mga05p37_116945_c1 nmdc:mga05p37_116945_c1_665_1948 418
144 3300050508 nmdc:mga09592_176491_c1 nmdc:mga09592_176491_c1_290_1573 418
145 3300050508 nmdc:mga09592_255186_c1 nmdc:mga09592_255186_c1_227_1498 418
146 3300060353 Ga0501082_0265137 Ga0501082_0265137_221_1477 418
147 3300039093 Ga0400489_95230 Ga0400489_95230_1205_2491 419
148 3300031727 Ga0316576_10001561 Ga0316576_100015614 420
149 3300031727 Ga0316576_10004113 Ga0316576_100041136 420
150 3300031727 Ga0316576_10022949 Ga0316576_100229494 420
151 3300031728 Ga0316578_10013141 Ga0316578_100131413 420
152 3300031728 Ga0316578_10059593 Ga0316578_100595932 420
153 3300031733 Ga0316577_10017738 Ga0316577_100177382 420
154 3300032137 Ga0316585_10000125 Ga0316585_1000012510 420
155 3300032137 Ga0316585_10010567 Ga0316585_100105672 420
156 3300032139 Ga0316580_10000044 Ga0316580_100000447 420
157 3300033541 Ga0316596_1002093 Ga0316596_10020932 420
158 3300036647 Ga0316582_0107849 Ga0316582_0107849_371_1717 420
159 3300036712 Ga0316584_0004207 Ga0316584_0004207_7282_8628 420
160 3300036712 Ga0316584_0018857 Ga0316584_0018857_3404_4717 420
161 3300045051 Ga0451576_0031575 Ga0451576_0031575_3721_5154 420
162 3300044712 Ga0453684_0001196 Ga0453684_0001196_51305_52651 421
163 3300044712 Ga0453684_0001239 Ga0453684_0001239_29301_30611 421
164 2162886007 SwRhRL2b_contig_1076749 SwRhRL2b_0878.00006900 422
165 3300009148 Ga0105243_10068771 Ga0105243_100687714 422
166 3300035115 Ga0373941_0036785 Ga0373941_0036785_38_1306 422

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

267

449

0.95

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

80

261

0.95

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

280

435

0.89

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

81

256

0.85

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

336

464

0.81

PF20706

GT4-conflict

Family 4 Glycosyltransferase in conflict systems

75

462

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c4q-assembly2.cif.gz_B structure of the retaining glycosyltransferase msha : the first step in mycothiol biosynthesis. organism : corynebacterium glutamicum- complex with udp 0.9234 6 417
3c4q-assembly2.cif.gz_B structure of the retaining glycosyltransferase msha : the first step in mycothiol biosynthesis. organism : corynebacterium glutamicum- complex with udp 0.9212 6 417
3c4q-assembly1.cif.gz_A structure of the retaining glycosyltransferase msha : the first step in mycothiol biosynthesis. organism : corynebacterium glutamicum- complex with udp 0.9201 6 417
6kih-assembly2.cif.gz_B sucrose-phosphate synthase (tll1590) from thermosynechococcus elongatus 0.9187 6 413
3c4q-assembly1.cif.gz_A structure of the retaining glycosyltransferase msha : the first step in mycothiol biosynthesis. organism : corynebacterium glutamicum- complex with udp 0.9179 6 417
ID Description Score Start End Superfamily
af_Q2G0L3_321_481_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9461 232 401 3.40.50.2000
af_Q2G0L2_318_480_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9394 224 397 3.40.50.2000
3c4vA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9341 204 393 3.40.50.2000
af_Q2G0L2_318_480_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9339 224 397 3.40.50.2000
af_P9WMY9_212_374_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9316 224 392 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A6N8W839-F1-model_v4 Glycosyltransferase family 1 protein 0.9423 29 421 GO:0016757
AF-A0A831V2K2-F1-model_v4 Glycosyltransferase family 1 protein 0.9378 5 193 GO:0016757
AF-A0A069S8H6-F1-model_v4 deleted 0.935 229 415
AF-A0A800CH53-F1-model_v4 Glycosyltransferase family 1 protein 0.9346 22 241 GO:0016758
AF-A0A353VF63-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9294 172 416 GO:0016757

Feature Viewer

pLDDT pTM Quality
88.91 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map