F248631

General Info

Members Datasets Scaffolds Average Seq Length
166 111 332 193

Family's Representative Sequence

Representative Sequence 3300028577|Ga0265318_10003852|Ga0265318_100038527
Length 211
Sequence MTRAIAGFGWIRSRWLDMLVSMPHSVILDHMFQMPLPILEKLARPVIVYLVLVLLLRLFGKRELAQLNPFDLVVLLSLSNTVQNAIIGDDNSVSGGVIGAFGLLAINWLVVRVLFRSPSLTRMFEGRSTVLVRHGQIDRKALGREALTQEELVEVIHRQGFERLSQVKRCELEPNGIFYIEGFEPSVAETQHAQLVEKLDALTREVAALRR

Samples

Sample ID Description Type Environment
1 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
70 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
71 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
82 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
95 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
103 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
110 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.2
Rhizosphere 97.59
Stem 0
Stem Tuber 0
Unclassified 11.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265318_10003852 3300028577 Bacteria 7417
2 rootH2_10041655 3300003320 Bacteria 2281
3 Ga0070658_10000010 3300005327 Bacteria 297212
4 Ga0070658_10860056 3300005327 Bacteria 788
5 Ga0070687_100043027 3300005343 Bacteria 2292
6 Ga0070668_100227377 3300005347 Bacteria 1541
7 Ga0070668_100497082 3300005347 Bacteria 1055
8 Ga0070669_100043927 3300005353 Bacteria 3256
9 Ga0070709_10019216 3300005434 Bacteria 3946
10 Ga0070714_100039400 3300005435 Bacteria 3978
11 Ga0070711_100036855 3300005439 Bacteria 3279
12 Ga0070705_100518800 3300005440 Unclassified 908
13 Ga0070708_100012885 3300005445 Bacteria 6833
14 Ga0070708_100782863 3300005445 Bacteria 897
15 Ga0070681_10605035 3300005458 Bacteria 1010
16 Ga0070707_100135344 3300005468 Bacteria 2397
17 Ga0070707_100513412 3300005468 Unclassified 1160
18 Ga0070698_100384256 3300005471 Bacteria 1336
19 Ga0070698_100908785 3300005471 Bacteria 826
20 Ga0070697_100079934 3300005536 Bacteria 2693
21 Ga0070697_100101211 3300005536 Bacteria 2394
22 Ga0070697_100477669 3300005536 Bacteria 1088
23 Ga0070672_100024679 3300005543 Bacteria 4447
24 Ga0070665_100003411 3300005548 Bacteria 16983
25 Ga0068855_100014200 3300005563 Bacteria 9594
26 Ga0068855_100310668 3300005563 Bacteria 1744
27 Ga0068856_100509746 3300005614 Unclassified 1224
28 Ga0070702_100125648 3300005615 Bacteria 1612
29 Ga0068852_100096899 3300005616 Bacteria 2652
30 Ga0068858_100000516 3300005842 Bacteria 40531
31 Ga0068860_100176800 3300005843 Bacteria 2063
32 Ga0068862_100135802 3300005844 Bacteria 2179
33 Ga0068862_100182644 3300005844 Bacteria 1883
34 Ga0070717_10037291 3300006028 Bacteria 3947
35 Ga0075431_100596141 3300006847 Bacteria 1089
36 Ga0075433_10163797 3300006852 Bacteria 1979
37 Ga0075433_10178503 3300006852 Unclassified 1889
38 Ga0075433_10240258 3300006852 Bacteria 1608
39 Ga0075433_10588700 3300006852 Bacteria 977
40 Ga0099794_10151596 3300007265 Unclassified 1177
41 Ga0105240_10003560 3300009093 Bacteria 24167
42 Ga0105240_10007723 3300009093 Bacteria 15561
43 Ga0105240_10068746 3300009093 Bacteria 4386
44 Ga0105240_10102325 3300009093 Bacteria 3481
45 Ga0105245_10045614 3300009098 Bacteria 3915
46 Ga0105245_10128667 3300009098 Unclassified 2373
47 Ga0105247_10032241 3300009101 Bacteria 3183
48 Ga0114129_10013283 3300009147 Bacteria 11734
49 Ga0114129_10039680 3300009147 Bacteria 6639
50 Ga0114129_10894007 3300009147 Bacteria 1126
51 Ga0105243_11194427 3300009148 Unclassified 773
52 Ga0105248_10000356 3300009177 Bacteria 53460
53 Ga0105248_10005386 3300009177 Bacteria 14065
54 Ga0105237_10025237 3300009545 Bacteria 6079
55 Ga0105238_10006099 3300009551 Bacteria 11954
56 Ga0105249_10209655 3300009553 Bacteria 1911
57 Ga0105239_10001917 3300010375 Bacteria 27103
58 Ga0105239_10411435 3300010375 Bacteria 1531
59 Ga0157373_10329831 3300013100 Bacteria 1086
60 Ga0157371_10259095 3300013102 Bacteria 1254
61 Ga0157370_10043955 3300013104 Bacteria 4297
62 Ga0157370_10046963 3300013104 Bacteria 4140
63 Ga0157370_10377429 3300013104 Bacteria 1306
64 Ga0157369_10291777 3300013105 Bacteria 1698
65 Ga0157369_10360103 3300013105 Bacteria 1510
66 Ga0157374_10027882 3300013296 Bacteria 5099
67 Ga0157378_10024183 3300013297 Bacteria 5343
68 Ga0157378_10114890 3300013297 Bacteria 2473
69 Ga0157372_10064179 3300013307 Bacteria 4120
70 Ga0157372_10255411 3300013307 Bacteria 2035
71 Ga0157372_10988647 3300013307 Unclassified 975
72 Ga0163163_10406931 3300014325 Bacteria 1419
73 Ga0157380_10076770 3300014326 Bacteria 2720
74 Ga0157379_10157827 3300014968 Bacteria 2047
75 Ga0157379_10188927 3300014968 Unclassified 1862
76 Ga0157376_10015407 3300014969 Bacteria 5775
77 Ga0157376_11415913 3300014969 Bacteria 727
78 Ga0207710_10095447 3300025900 Bacteria 1397
79 Ga0207647_10037179 3300025904 Bacteria 3089
80 Ga0207705_10000016 3300025909 Bacteria 377359
81 Ga0207657_10339198 3300025919 Bacteria 1186
82 Ga0207646_10114914 3300025922 Bacteria 2417
83 Ga0207646_10577665 3300025922 Unclassified 1010
84 Ga0207681_10095102 3300025923 Bacteria 2136
85 Ga0207664_10301080 3300025929 Bacteria 1411
86 Ga0207709_10382618 3300025935 Unclassified 1071
87 Ga0207670_10199698 3300025936 Bacteria 1519
88 Ga0207711_10004975 3300025941 Bacteria 11273
89 Ga0207667_10009723 3300025949 Bacteria 11306
90 Ga0207667_10183281 3300025949 Bacteria 2149
91 Ga0207712_10121148 3300025961 Bacteria 1979
92 Ga0207668_10140236 3300025972 Bacteria 1858
93 Ga0207703_10041173 3300026035 Bacteria 3700
94 Ga0207703_11584988 3300026035 Bacteria 630
95 Ga0207698_10115320 3300026142 Bacteria 2262
96 Ga0268265_10013230 3300028380 Bacteria 5607
97 Ga0268265_10247152 3300028380 Bacteria 1578
98 Ga0268264_10193786 3300028381 Bacteria 1854
99 Ga0265336_10011708 3300028666 Bacteria 2972
100 Ga0265338_10005982 3300028800 Bacteria 15649
101 Ga0265338_10007424 3300028800 Bacteria 13605
102 Ga0265338_10320313 3300028800 Bacteria 1122
103 Ga0265330_10001327 3300031235 Bacteria 14457
104 Ga0265330_10099344 3300031235 Bacteria 1246
105 Ga0265332_10043318 3300031238 Bacteria 1944
106 Ga0265328_10000474 3300031239 Bacteria 18651
107 Ga0265320_10095309 3300031240 Bacteria 1375
108 Ga0265325_10000020 3300031241 Bacteria 125088
109 Ga0265325_10096848 3300031241 Bacteria 1449
110 Ga0265325_10356943 3300031241 Bacteria 645
111 Ga0265329_10016702 3300031242 Bacteria 2539
112 Ga0265340_10011455 3300031247 Bacteria 4711
113 Ga0265340_10016160 3300031247 Unclassified 3868
114 Ga0265340_10055112 3300031247 Bacteria 1916
115 Ga0265339_10001765 3300031249 Bacteria 15942
116 Ga0265339_10089347 3300031249 Bacteria 1617
117 Ga0265339_10153502 3300031249 Bacteria 1162
118 Ga0265331_10032400 3300031250 Bacteria 2590
119 Ga0265316_10007120 3300031344 Bacteria 10581
120 Ga0265316_10014777 3300031344 Bacteria 6853
121 Ga0265316_10088040 3300031344 Unclassified 2372
122 Ga0265316_10243716 3300031344 Bacteria 1321
123 Ga0265316_10371209 3300031344 Bacteria 1033
124 Ga0265313_10002959 3300031595 Bacteria 14175
125 Ga0265314_10000033 3300031711 Bacteria 254594
126 Ga0265314_10007405 3300031711 Bacteria 9517
127 Ga0265314_10094069 3300031711 Bacteria 1944
128 Ga0265314_10266392 3300031711 Bacteria 976
129 Ga0265342_10000484 3300031712 Bacteria 43080
130 Ga0265342_10016454 3300031712 Bacteria 4834
131 Ga0265342_10079514 3300031712 Bacteria 1896
132 Ga0373946_0275380 3300035171 Bacteria 827
133 Ga0373955_0324561 3300035172 Bacteria 930
134 Ga0373937_0689177 3300036401 Bacteria 968
135 Ga0373937_0761238 3300036401 Bacteria 916
136 Ga0395900_0076485 3300037418 Bacteria 3440
137 Ga0395898_0023139 3300037466 Bacteria 6281
138 Ga0395901_0299737 3300038443 Unclassified 1667
139 Ga0436365_1582337 3300039437 Bacteria 1800
140 Ga0436362_0411131 3300039453 Bacteria 734
141 Ga0466963_0512240 3300044694 Bacteria 847
142 Ga0453684_0189412 3300044712 Bacteria 2408
143 Ga0495580_0737678 3300046472 Unclassified 642
144 Ga0495618_0511547 3300046514 Bacteria 723
145 Ga0495640_0533117 3300046533 Bacteria 713
146 Ga0495586_0009589 3300046535 Bacteria 5158
147 Ga0495667_0506099 3300046559 Bacteria 756
148 Ga0495658_0296094 3300046683 Bacteria 1023
149 Ga0495669_0001949 3300046684 Bacteria 8479
150 Ga0495613_0066862 3300046689 Bacteria 2624
151 Ga0495674_0126008 3300047319 Bacteria 2161
152 Ga0495680_0006863 3300047322 Bacteria 10518
153 Ga0495684_0327390 3300047471 Bacteria 1094
154 Ga0495593_0194870 3300047673 Unclassified 1019
155 Ga0496108_0889030 3300048911 Bacteria 765
156 Ga0496112_0247036 3300048915 Unclassified 1736
157 nmdc:mga05p37_197389_c1 3300050507 Bacteria 2439
158 nmdc:mga05p37_21466_c1 3300050507 Bacteria 7821
159 nmdc:mga05p37_273254_c1 3300050507 Bacteria 2018
160 nmdc:mga06r32_750529_c1 3300050510 Unclassified 939
161 nmdc:mga08x19_431945_c1 3300050514 Bacteria 926
162 nmdc:mga0a205_231232_c1 3300050515 Unclassified 1732
163 nmdc:mga0a205_612860_c1 3300050515 Bacteria 941
164 Ga0495601_0027304 3300053077 Bacteria 3529
165 Ga0495601_0464209 3300053077 Bacteria 818
166 Ga0495619_0134800 3300053085 Bacteria 1698
167 Ga0265318_10003852
168 rootH2_10041655
169 Ga0070658_10000010
170 Ga0070658_10860056
171 Ga0070687_100043027
172 Ga0070668_100227377
173 Ga0070668_100497082
174 Ga0070669_100043927
175 Ga0070709_10019216
176 Ga0070714_100039400
177 Ga0070711_100036855
178 Ga0070705_100518800
179 Ga0070708_100012885
180 Ga0070708_100782863
181 Ga0070681_10605035
182 Ga0070707_100135344
183 Ga0070707_100513412
184 Ga0070698_100384256
185 Ga0070698_100908785
186 Ga0070697_100079934
187 Ga0070697_100101211
188 Ga0070697_100477669
189 Ga0070672_100024679
190 Ga0070665_100003411
191 Ga0068855_100014200
192 Ga0068855_100310668
193 Ga0068856_100509746
194 Ga0070702_100125648
195 Ga0068852_100096899
196 Ga0068858_100000516
197 Ga0068860_100176800
198 Ga0068862_100135802
199 Ga0068862_100182644
200 Ga0070717_10037291
201 Ga0075431_100596141
202 Ga0075433_10163797
203 Ga0075433_10178503
204 Ga0075433_10240258
205 Ga0075433_10588700
206 Ga0099794_10151596
207 Ga0105240_10003560
208 Ga0105240_10007723
209 Ga0105240_10068746
210 Ga0105240_10102325
211 Ga0105245_10045614
212 Ga0105245_10128667
213 Ga0105247_10032241
214 Ga0114129_10013283
215 Ga0114129_10039680
216 Ga0114129_10894007
217 Ga0105243_11194427
218 Ga0105248_10000356
219 Ga0105248_10005386
220 Ga0105237_10025237
221 Ga0105238_10006099
222 Ga0105249_10209655
223 Ga0105239_10001917
224 Ga0105239_10411435
225 Ga0157373_10329831
226 Ga0157371_10259095
227 Ga0157370_10043955
228 Ga0157370_10046963
229 Ga0157370_10377429
230 Ga0157369_10291777
231 Ga0157369_10360103
232 Ga0157374_10027882
233 Ga0157378_10024183
234 Ga0157378_10114890
235 Ga0157372_10064179
236 Ga0157372_10255411
237 Ga0157372_10988647
238 Ga0163163_10406931
239 Ga0157380_10076770
240 Ga0157379_10157827
241 Ga0157379_10188927
242 Ga0157376_10015407
243 Ga0157376_11415913
244 Ga0207710_10095447
245 Ga0207647_10037179
246 Ga0207705_10000016
247 Ga0207657_10339198
248 Ga0207646_10114914
249 Ga0207646_10577665
250 Ga0207681_10095102
251 Ga0207664_10301080
252 Ga0207709_10382618
253 Ga0207670_10199698
254 Ga0207711_10004975
255 Ga0207667_10009723
256 Ga0207667_10183281
257 Ga0207712_10121148
258 Ga0207668_10140236
259 Ga0207703_10041173
260 Ga0207703_11584988
261 Ga0207698_10115320
262 Ga0268265_10013230
263 Ga0268265_10247152
264 Ga0268264_10193786
265 Ga0265336_10011708
266 Ga0265338_10005982
267 Ga0265338_10007424
268 Ga0265338_10320313
269 Ga0265330_10001327
270 Ga0265330_10099344
271 Ga0265332_10043318
272 Ga0265328_10000474
273 Ga0265320_10095309
274 Ga0265325_10000020
275 Ga0265325_10096848
276 Ga0265325_10356943
277 Ga0265329_10016702
278 Ga0265340_10011455
279 Ga0265340_10016160
280 Ga0265340_10055112
281 Ga0265339_10001765
282 Ga0265339_10089347
283 Ga0265339_10153502
284 Ga0265331_10032400
285 Ga0265316_10007120
286 Ga0265316_10014777
287 Ga0265316_10088040
288 Ga0265316_10243716
289 Ga0265316_10371209
290 Ga0265313_10002959
291 Ga0265314_10000033
292 Ga0265314_10007405
293 Ga0265314_10094069
294 Ga0265314_10266392
295 Ga0265342_10000484
296 Ga0265342_10016454
297 Ga0265342_10079514
298 Ga0373946_0275380
299 Ga0373955_0324561
300 Ga0373937_0689177
301 Ga0373937_0761238
302 Ga0395900_0076485
303 Ga0395898_0023139
304 Ga0395901_0299737
305 Ga0436365_1582337
306 Ga0436362_0411131
307 Ga0466963_0512240
308 Ga0453684_0189412
309 Ga0495580_0737678
310 Ga0495618_0511547
311 Ga0495640_0533117
312 Ga0495586_0009589
313 Ga0495667_0506099
314 Ga0495658_0296094
315 Ga0495669_0001949
316 Ga0495613_0066862
317 Ga0495674_0126008
318 Ga0495680_0006863
319 Ga0495684_0327390
320 Ga0495593_0194870
321 Ga0496108_0889030
322 Ga0496112_0247036
323 nmdc:mga05p37_197389_c1
324 nmdc:mga05p37_21466_c1
325 nmdc:mga05p37_273254_c1
326 nmdc:mga06r32_750529_c1
327 nmdc:mga08x19_431945_c1
328 nmdc:mga0a205_231232_c1
329 nmdc:mga0a205_612860_c1
330 Ga0495601_0027304
331 Ga0495601_0464209
332 Ga0495619_0134800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04239

DUF421

YetF C-terminal domain

115

197

0.92

Map