F248553

General Info

Members Datasets Scaffolds Average Seq Length
166 140 332 133

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10081624|Ga0207665_100816241
Length 158
Sequence MSQAKEVKSDRKYTKDHEWALSEGAELVVGITAFAVDALGDITLVSLDVKPGDRVEAHKAFGTIESVKTLSDLFAPVSGKITRVNAALENAPELVNEDCWGKAWMIAIAPGKNGNSEEHRTKTPGFSSITFRIARLAGKSIPNGFSPNKCFPARMMSV

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
63 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
85 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
94 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
95 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
96 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
97 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
98 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
99 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
100 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
101 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
102 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
103 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
133 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
134 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
135 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
136 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.58
Metatranscriptomes 5.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.41
Nodule 0
Rhizoplane 6.63
Rhizosphere 81.93
Stem 0
Stem Tuber 0
Unclassified 9.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10081624 3300025939 Unclassified 2227
2 Ga0006758J48902_1019332 3300003300 Unclassified 602
3 rootH1_10172286 3300003316 Bacteria 1339
4 rootH2_10019517 3300003320 Bacteria 6956
5 rootH2_10087560 3300003320 Unclassified 1603
6 rootL2_10252314 3300003322 Bacteria 1110
7 rootL2_10318602 3300003322 Bacteria 1350
8 rootH1_10012453 3300003323 Bacteria 6627
9 rootH1_10096639 3300003323 Bacteria 1496
10 Ga0070682_100454189 3300005337 Bacteria 982
11 Ga0070691_10109673 3300005341 Bacteria 1379
12 Ga0070692_10664230 3300005345 Unclassified 697
13 Ga0070668_100498073 3300005347 Unclassified 1054
14 Ga0070659_100447441 3300005366 Bacteria 1095
15 Ga0070667_101420124 3300005367 Bacteria 651
16 Ga0070701_10153882 3300005438 Bacteria 1326
17 Ga0070711_101543296 3300005439 Bacteria 580
18 Ga0070663_100002872 3300005455 Bacteria 9800
19 Ga0070678_100457042 3300005456 Bacteria 1119
20 Ga0068867_100349077 3300005459 Bacteria 1234
21 Ga0070706_100908989 3300005467 Bacteria 813
22 Ga0070684_100328262 3300005535 Bacteria 1406
23 Ga0068853_101317270 3300005539 Bacteria 698
24 Ga0068855_100000059 3300005563 Bacteria 134064
25 Ga0068855_100011073 3300005563 Bacteria 10884
26 Ga0070664_100275281 3300005564 Bacteria 1517
27 Ga0068856_100004157 3300005614 Bacteria 14465
28 Ga0070702_100572105 3300005615 Bacteria 842
29 Ga0068859_100075584 3300005617 Bacteria 3409
30 Ga0068864_101271866 3300005618 Bacteria 736
31 Ga0068861_100001562 3300005719 Bacteria 14561
32 Ga0068861_100620257 3300005719 Bacteria 995
33 Ga0081455_10765027 3300005937 Bacteria 609
34 Ga0068871_100725005 3300006358 Bacteria 912
35 Ga0075428_100178107 3300006844 Bacteria 2302
36 Ga0075428_100672260 3300006844 Bacteria 1104
37 Ga0075430_100017853 3300006846 Bacteria 6039
38 Ga0075431_100648728 3300006847 Bacteria 1036
39 Ga0068865_101008794 3300006881 Bacteria 729
40 Ga0075436_100802599 3300006914 Bacteria 701
41 Ga0097620_100075584 3300006931 Bacteria 3409
42 Ga0111539_10417130 3300009094 Bacteria 1564
43 Ga0111539_10741364 3300009094 Bacteria 1143
44 Ga0111539_12318821 3300009094 Bacteria 623
45 Ga0105245_10003879 3300009098 Bacteria 13300
46 Ga0114129_10371535 3300009147 Bacteria 1890
47 Ga0105243_11797763 3300009148 Unclassified 644
48 Ga0105241_10003113 3300009174 Bacteria 12347
49 Ga0105248_13277133 3300009177 Bacteria 515
50 Ga0105238_11760608 3300009551 Unclassified 651
51 Ga0163163_10040716 3300014325 Bacteria 4539
52 Ga0157380_11639743 3300014326 Bacteria 699
53 Ga0157376_10067126 3300014969 Bacteria 3033
54 Ga0157376_10681859 3300014969 Bacteria 1031
55 Ga0157376_10955750 3300014969 Bacteria 877
56 Ga0157376_11149587 3300014969 Bacteria 803
57 Ga0157376_12606656 3300014969 Bacteria 545
58 Ga0206349_1918834 3300020075 Bacteria 603
59 Ga0207654_10024233 3300025911 Bacteria 3260
60 Ga0207694_10702317 3300025924 Bacteria 853
61 Ga0207687_10142247 3300025927 Bacteria 1821
62 Ga0207709_11179500 3300025935 Unclassified 630
63 Ga0207704_10150098 3300025938 Unclassified 1643
64 Ga0207679_10219032 3300025945 Bacteria 1601
65 Ga0207667_10001382 3300025949 Bacteria 30435
66 Ga0207667_10037790 3300025949 Bacteria 5160
67 Ga0207640_11980047 3300025981 Bacteria 528
68 Ga0207639_11180172 3300026041 Bacteria 718
69 Ga0207678_10066549 3300026067 Bacteria 3094
70 Ga0207678_11651074 3300026067 Bacteria 563
71 Ga0207702_11333208 3300026078 Bacteria 712
72 Ga0207702_12143854 3300026078 Bacteria 548
73 Ga0207648_11086359 3300026089 Bacteria 750
74 Ga0207676_10226060 3300026095 Bacteria 1670
75 Ga0207676_11044979 3300026095 Bacteria 806
76 Ga0207675_100000293 3300026118 Bacteria 48222
77 Ga0207675_100439936 3300026118 Bacteria 1290
78 Ga0207675_100598858 3300026118 Bacteria 1105
79 Ga0268265_10820780 3300028380 Bacteria 908
80 Ga0265337_1005972 3300028556 Bacteria 4755
81 Ga0265334_10003028 3300028573 Bacteria 7676
82 Ga0307515_10237102 3300028794 Bacteria 1603
83 Ga0265332_10157245 3300031238 Bacteria 950
84 Ga0265320_10003552 3300031240 Bacteria 10431
85 Ga0265339_10041827 3300031249 Bacteria 2541
86 Ga0307509_10584552 3300031507 Unclassified 791
87 Ga0307508_10004319 3300031616 Bacteria 13923
88 Ga0265314_10040651 3300031711 Bacteria 3336
89 Ga0265342_10066468 3300031712 Bacteria 2111
90 Ga0316576_10094704 3300031727 Bacteria 2227
91 Ga0316578_10231392 3300031728 Bacteria 1110
92 Ga0316578_10537419 3300031728 Bacteria 687
93 Ga0307516_10004907 3300031730 Bacteria 16270
94 Ga0316577_10587837 3300031733 Unclassified 633
95 Ga0307413_11357169 3300031824 Bacteria 624
96 Ga0307410_10612885 3300031852 Bacteria 909
97 Ga0326468_10007281 3300031889 Bacteria 1045
98 Ga0307406_10028753 3300031901 Bacteria 3360
99 Ga0307412_10123810 3300031911 Bacteria 1866
100 Ga0307409_101249262 3300031995 Bacteria 767
101 Ga0307411_10966301 3300032005 Bacteria 761
102 Ga0307415_100024068 3300032126 Bacteria 3795
103 Ga0316583_10108887 3300032133 Bacteria 966
104 Ga0373945_0130620 3300035116 Bacteria 1006
105 Ga0373955_0375882 3300035172 Bacteria 862
106 Ga0316574_0140560 3300035398 Bacteria 1555
107 Ga0373935_0655671 3300035692 Bacteria 770
108 Ga0373927_0879640 3300035695 Bacteria 591
109 Ga0373933_0062825 3300035724 Bacteria 2244
110 Ga0373937_0274431 3300036401 Bacteria 1592
111 Ga0373937_0324467 3300036401 Bacteria 1457
112 Ga0373925_0059380 3300037068 Bacteria 2869
113 Ga0373925_0957928 3300037068 Unclassified 705
114 Ga0451787_546602 3300041441 Bacteria 738
115 Ga0451791_0605091 3300041451 Bacteria 671
116 Ga0451793_1677054 3300041452 Bacteria 537
117 Ga0451797_0672611 3300041453 Bacteria 893
118 Ga0451795_0167212 3300041456 Bacteria 607
119 Ga0451798_0114086 3300041458 Unclassified 659
120 Ga0451800_0968311 3300041459 Unclassified 883
121 Ga0451802_0093844 3300041460 Bacteria 613
122 Ga0451807_0694273 3300041486 Bacteria 1071
123 Ga0451807_1843033 3300041486 Bacteria 3564
124 Ga0451807_2013674 3300041486 Bacteria 514
125 Ga0451845_0343648 3300041501 Bacteria 672
126 Ga0451843_0069359 3300041509 Bacteria 557
127 Ga0451853_1138114 3300041512 Bacteria 523
128 Ga0451853_3352894 3300041512 Bacteria 788
129 Ga0439445_0036276 3300042004 Bacteria 1297
130 Ga0466965_0798907 3300044683 Bacteria 546
131 Ga0466968_0386318 3300044735 Bacteria 684
132 Ga0466960_0016289 3300044901 Bacteria 3221
133 Ga0451576_0335172 3300045051 Bacteria 1583
134 Ga0495629_0377899 3300046459 Bacteria 964
135 Ga0495581_0597211 3300047315 Bacteria 639
136 Ga0495680_0025508 3300047322 Bacteria 4890
137 Ga0501310_038588 3300049130 Bacteria 658
138 Ga0501305_087924 3300049161 Bacteria 566
139 Ga0501312_032706 3300049528 Bacteria 822
140 Ga0501336_010341 3300049552 Bacteria 746
141 Ga0501033_0995733 3300049570 Bacteria 560
142 Ga0501034_0266459 3300049571 Bacteria 1655
143 Ga0501036_1638714 3300049572 Bacteria 519
144 Ga0501047_0066264 3300049581 Bacteria 3481
145 Ga0501067_0091276 3300049583 Bacteria 1691
146 Ga0501069_0138617 3300049585 Bacteria 1395
147 Ga0501074_1033932 3300049590 Bacteria 577
148 Ga0501198_107660 3300049649 Unclassified 573
149 Ga0501080_0557335 3300049742 Bacteria 1020
150 Ga0501083_0024366 3300049744 Bacteria 4193
151 Ga0501035_0654870 3300049822 Bacteria 851
152 Ga0501044_0467556 3300049823 Bacteria 1166
153 nmdc:mga05p37_285304_c1 3300050507 Bacteria 1967
154 nmdc:mga0qj67_1304343_c1 3300050509 Bacteria 562
155 nmdc:mga0qj67_18508_c1 3300050509 Bacteria 5309
156 nmdc:mga06r32_368178_c1 3300050510 Bacteria 1420
157 nmdc:mga08x19_783655_c1 3300050514 Bacteria 677
158 Ga0500635_0041871 3300053080 Bacteria 1534
159 Ga0500647_0379387 3300053091 Bacteria 579
160 Ga0500650_0241119 3300053098 Bacteria 813
161 Ga0500555_031962 3300053103 Bacteria 1489
162 Ga0501084_0860423 3300054114 Bacteria 763
163 Ga0587085_096507 3300059506 Bacteria 618
164 Ga0587085_109981 3300059506 Bacteria 593
165 Ga0587109_059786 3300059624 Bacteria 800
166 Ga0501082_0453764 3300060353 Bacteria 1120
167 Ga0207665_10081624
168 Ga0006758J48902_1019332
169 rootH1_10172286
170 rootH2_10019517
171 rootH2_10087560
172 rootL2_10252314
173 rootL2_10318602
174 rootH1_10012453
175 rootH1_10096639
176 Ga0070682_100454189
177 Ga0070691_10109673
178 Ga0070692_10664230
179 Ga0070668_100498073
180 Ga0070659_100447441
181 Ga0070667_101420124
182 Ga0070701_10153882
183 Ga0070711_101543296
184 Ga0070663_100002872
185 Ga0070678_100457042
186 Ga0068867_100349077
187 Ga0070706_100908989
188 Ga0070684_100328262
189 Ga0068853_101317270
190 Ga0068855_100000059
191 Ga0068855_100011073
192 Ga0070664_100275281
193 Ga0068856_100004157
194 Ga0070702_100572105
195 Ga0068859_100075584
196 Ga0068864_101271866
197 Ga0068861_100001562
198 Ga0068861_100620257
199 Ga0081455_10765027
200 Ga0068871_100725005
201 Ga0075428_100178107
202 Ga0075428_100672260
203 Ga0075430_100017853
204 Ga0075431_100648728
205 Ga0068865_101008794
206 Ga0075436_100802599
207 Ga0097620_100075584
208 Ga0111539_10417130
209 Ga0111539_10741364
210 Ga0111539_12318821
211 Ga0105245_10003879
212 Ga0114129_10371535
213 Ga0105243_11797763
214 Ga0105241_10003113
215 Ga0105248_13277133
216 Ga0105238_11760608
217 Ga0163163_10040716
218 Ga0157380_11639743
219 Ga0157376_10067126
220 Ga0157376_10681859
221 Ga0157376_10955750
222 Ga0157376_11149587
223 Ga0157376_12606656
224 Ga0206349_1918834
225 Ga0207654_10024233
226 Ga0207694_10702317
227 Ga0207687_10142247
228 Ga0207709_11179500
229 Ga0207704_10150098
230 Ga0207679_10219032
231 Ga0207667_10001382
232 Ga0207667_10037790
233 Ga0207640_11980047
234 Ga0207639_11180172
235 Ga0207678_10066549
236 Ga0207678_11651074
237 Ga0207702_11333208
238 Ga0207702_12143854
239 Ga0207648_11086359
240 Ga0207676_10226060
241 Ga0207676_11044979
242 Ga0207675_100000293
243 Ga0207675_100439936
244 Ga0207675_100598858
245 Ga0268265_10820780
246 Ga0265337_1005972
247 Ga0265334_10003028
248 Ga0307515_10237102
249 Ga0265332_10157245
250 Ga0265320_10003552
251 Ga0265339_10041827
252 Ga0307509_10584552
253 Ga0307508_10004319
254 Ga0265314_10040651
255 Ga0265342_10066468
256 Ga0316576_10094704
257 Ga0316578_10231392
258 Ga0316578_10537419
259 Ga0307516_10004907
260 Ga0316577_10587837
261 Ga0307413_11357169
262 Ga0307410_10612885
263 Ga0326468_10007281
264 Ga0307406_10028753
265 Ga0307412_10123810
266 Ga0307409_101249262
267 Ga0307411_10966301
268 Ga0307415_100024068
269 Ga0316583_10108887
270 Ga0373945_0130620
271 Ga0373955_0375882
272 Ga0316574_0140560
273 Ga0373935_0655671
274 Ga0373927_0879640
275 Ga0373933_0062825
276 Ga0373937_0274431
277 Ga0373937_0324467
278 Ga0373925_0059380
279 Ga0373925_0957928
280 Ga0451787_546602
281 Ga0451791_0605091
282 Ga0451793_1677054
283 Ga0451797_0672611
284 Ga0451795_0167212
285 Ga0451798_0114086
286 Ga0451800_0968311
287 Ga0451802_0093844
288 Ga0451807_0694273
289 Ga0451807_1843033
290 Ga0451807_2013674
291 Ga0451845_0343648
292 Ga0451843_0069359
293 Ga0451853_1138114
294 Ga0451853_3352894
295 Ga0439445_0036276
296 Ga0466965_0798907
297 Ga0466968_0386318
298 Ga0466960_0016289
299 Ga0451576_0335172
300 Ga0495629_0377899
301 Ga0495581_0597211
302 Ga0495680_0025508
303 Ga0501310_038588
304 Ga0501305_087924
305 Ga0501312_032706
306 Ga0501336_010341
307 Ga0501033_0995733
308 Ga0501034_0266459
309 Ga0501036_1638714
310 Ga0501047_0066264
311 Ga0501067_0091276
312 Ga0501069_0138617
313 Ga0501074_1033932
314 Ga0501198_107660
315 Ga0501080_0557335
316 Ga0501083_0024366
317 Ga0501035_0654870
318 Ga0501044_0467556
319 nmdc:mga05p37_285304_c1
320 nmdc:mga0qj67_1304343_c1
321 nmdc:mga0qj67_18508_c1
322 nmdc:mga06r32_368178_c1
323 nmdc:mga08x19_783655_c1
324 Ga0500635_0041871
325 Ga0500647_0379387
326 Ga0500650_0241119
327 Ga0500555_031962
328 Ga0501084_0860423
329 Ga0587085_096507
330 Ga0587085_109981
331 Ga0587109_059786
332 Ga0501082_0453764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

11

124

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9653 6 132
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9535 9 134
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9514 6 131
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9506 6 132
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9462 9 134
ID Description Score Start End Superfamily
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.967 9 128 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9529 9 134 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9456 9 134 2.40.50.100
af_Q4E4F5_6_138_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.944 9 129 2.40.50.100
3a8jE00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9419 7 130 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A7Y4ZPK1-F1-model_v4 Glycine cleavage system H protein 0.9896 6 131 GO:0005829
GO:0005960
GO:0019464
AF-A0A2P8HUI4-F1-model_v4 Glycine cleavage system H protein 0.9894 6 132 GO:0005737
GO:0005960
GO:0019464
AF-A0A7Y5NLZ5-F1-model_v4 Glycine cleavage system H protein 0.9888 6 134 GO:0005829
GO:0005960
GO:0019464
AF-A0A1S7LMX4-F1-model_v4 Glycine cleavage system H protein 0.9861 6 131 GO:0005829
GO:0005960
GO:0019464
AF-A0A5J6XR88-F1-model_v4 Glycine cleavage system H protein (Octanoyl/lipoyl carrier protein) 0.9846 6 131 GO:0005829
GO:0005960
GO:0019464

Map