F248374

General Info

Members Datasets Scaffolds Average Seq Length
166 118 332 80

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10143557|Ga0157374_101435572
Length 91
Sequence LKQTRLSGVDYGAMPIYEYELCDGNCVVCGGKFTLRRPLSAKELTNCPACKKPVRKVWSTFNSPKALSISDAKKAGFTVLKKVGKGEYEKQ

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
63 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
64 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
67 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
111 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
114 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.6
Rhizosphere 99.4
Stem 0
Stem Tuber 0
Unclassified 47.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10143557 3300013296 Unclassified 2318
2 Ga0070683_101418814 3300005329 Bacteria 667
3 Ga0070683_101951473 3300005329 Unclassified 564
4 Ga0070690_100000306 3300005330 Bacteria 25314
5 Ga0070670_100557287 3300005331 Bacteria 1023
6 Ga0070677_10304904 3300005333 Bacteria 810
7 Ga0068868_100263474 3300005338 Unclassified 1454
8 Ga0070668_100080907 3300005347 Bacteria 2546
9 Ga0070688_100090977 3300005365 Bacteria 1993
10 Ga0070688_101205442 3300005365 Bacteria 608
11 Ga0070659_102088068 3300005366 Unclassified 509
12 Ga0070713_101651259 3300005436 Bacteria 622
13 Ga0070710_10893464 3300005437 Bacteria 641
14 Ga0070700_100493495 3300005441 Bacteria 940
15 Ga0068867_101823006 3300005459 Bacteria 572
16 Ga0070685_10194297 3300005466 Bacteria 1315
17 Ga0070685_10907360 3300005466 Unclassified 656
18 Ga0070672_101708674 3300005543 Unclassified 565
19 Ga0070686_100004755 3300005544 Bacteria 7490
20 Ga0070686_100502353 3300005544 Bacteria 941
21 Ga0070702_100552248 3300005615 Unclassified 855
22 Ga0068852_101650755 3300005616 Bacteria 663
23 Ga0068859_101614578 3300005617 Unclassified 716
24 Ga0068864_100301056 3300005618 Bacteria 1501
25 Ga0068863_101667578 3300005841 Unclassified 647
26 Ga0068862_100747765 3300005844 Unclassified 951
27 Ga0068862_100777860 3300005844 Bacteria 933
28 Ga0070717_11098380 3300006028 Unclassified 724
29 Ga0097621_100062237 3300006237 Unclassified 3064
30 Ga0068871_100033827 3300006358 Unclassified 4050
31 Ga0068871_100721902 3300006358 Unclassified 914
32 Ga0068871_101871833 3300006358 Bacteria 570
33 Ga0075428_101408387 3300006844 Unclassified 731
34 Ga0075430_100044104 3300006846 Bacteria 3771
35 Ga0075429_100143671 3300006880 Bacteria 2089
36 Ga0075429_101515654 3300006880 Bacteria 583
37 Ga0068865_100862139 3300006881 Unclassified 785
38 Ga0068865_100866312 3300006881 Unclassified 783
39 Ga0097620_101614191 3300006931 Unclassified 716
40 Ga0075435_101322750 3300007076 Unclassified 631
41 Ga0075435_101442759 3300007076 Unclassified 603
42 Ga0105240_10697954 3300009093 Bacteria 1108
43 Ga0111539_10460982 3300009094 Bacteria 1480
44 Ga0111539_10822486 3300009094 Bacteria 1081
45 Ga0111539_12165573 3300009094 Unclassified 645
46 Ga0105248_11180179 3300009177 Unclassified 865
47 Ga0105249_12390970 3300009553 Unclassified 601
48 Ga0105239_12055267 3300010375 Bacteria 664
49 Ga0105246_12289838 3300011119 Unclassified 528
50 Ga0157371_10227905 3300013102 Bacteria 1339
51 Ga0157374_10090980 3300013296 Unclassified 2909
52 Ga0157378_10527749 3300013297 Bacteria 1183
53 Ga0157378_11125572 3300013297 Unclassified 823
54 Ga0163162_10178168 3300013306 Bacteria 2251
55 Ga0163162_11722851 3300013306 Unclassified 716
56 Ga0157372_10908984 3300013307 Bacteria 1021
57 Ga0157372_11123000 3300013307 Unclassified 909
58 Ga0157372_11907018 3300013307 Unclassified 683
59 Ga0157375_11829452 3300013308 Bacteria 720
60 Ga0157375_13069107 3300013308 Bacteria 557
61 Ga0157375_13697189 3300013308 Unclassified 509
62 Ga0163163_12538410 3300014325 Unclassified 570
63 Ga0157380_11457792 3300014326 Unclassified 736
64 Ga0157380_12188472 3300014326 Bacteria 617
65 Ga0157380_12314120 3300014326 Unclassified 602
66 Ga0157379_10882951 3300014968 Bacteria 847
67 Ga0157376_10028679 3300014969 Bacteria 4427
68 Ga0157376_10528189 3300014969 Bacteria 1164
69 Ga0157376_10641001 3300014969 Bacteria 1062
70 Ga0157376_10871292 3300014969 Unclassified 917
71 Ga0157376_12282177 3300014969 Unclassified 580
72 Ga0157376_12333748 3300014969 Unclassified 574
73 Ga0207692_10391176 3300025898 Bacteria 865
74 Ga0207663_11588108 3300025916 Unclassified 527
75 Ga0207662_10592431 3300025918 Bacteria 771
76 Ga0207700_10521681 3300025928 Unclassified 1053
77 Ga0207686_10612443 3300025934 Unclassified 858
78 Ga0207670_10010071 3300025936 Bacteria 5426
79 Ga0207670_11126541 3300025936 Unclassified 663
80 Ga0207704_11116332 3300025938 Unclassified 670
81 Ga0207661_11038423 3300025944 Unclassified 755
82 Ga0207668_11406117 3300025972 Bacteria 629
83 Ga0207677_10406089 3300026023 Unclassified 1156
84 Ga0207708_10404912 3300026075 Bacteria 1129
85 Ga0207708_10559076 3300026075 Bacteria 966
86 Ga0207641_10121576 3300026088 Bacteria 2331
87 Ga0207675_102008177 3300026118 Unclassified 596
88 Ga0268266_11043136 3300028379 Bacteria 791
89 Ga0268266_12176003 3300028379 Unclassified 527
90 Ga0265338_10832265 3300028800 Unclassified 631
91 Ga0265338_11131077 3300028800 Unclassified 527
92 Ga0265330_10368695 3300031235 Bacteria 607
93 Ga0265332_10040741 3300031238 Bacteria 2010
94 Ga0265328_10037992 3300031239 Unclassified 1777
95 Ga0265325_10394941 3300031241 Bacteria 606
96 Ga0265329_10000531 3300031242 Bacteria 19656
97 Ga0265331_10254461 3300031250 Unclassified 788
98 Ga0265327_10014515 3300031251 Bacteria 5148
99 Ga0265316_10103791 3300031344 Bacteria 2158
100 Ga0307408_100266225 3300031548 Bacteria 1421
101 Ga0265314_10000297 3300031711 Bacteria 71274
102 Ga0307413_10746104 3300031824 Unclassified 818
103 Ga0307410_10895100 3300031852 Unclassified 760
104 Ga0307406_10553873 3300031901 Unclassified 941
105 Ga0307412_10152954 3300031911 Unclassified 1705
106 Ga0307416_101453215 3300032002 Unclassified 791
107 Ga0307411_10112175 3300032005 Bacteria 1954
108 Ga0373936_0187721 3300035113 Bacteria 909
109 Ga0373935_1002109 3300035692 Unclassified 620
110 Ga0373927_0080226 3300035695 Bacteria 2115
111 Ga0373947_0840177 3300035725 Unclassified 627
112 Ga0373947_1156933 3300035725 Unclassified 527
113 Ga0373925_0002345 3300037068 Bacteria 15214
114 Ga0373925_1242173 3300037068 Unclassified 612
115 Ga0395900_1718511 3300037418 Bacteria 538
116 Ga0395905_0273833 3300037471 Bacteria 1574
117 Ga0395905_1798320 3300037471 Unclassified 518
118 Ga0395901_1692396 3300038443 Bacteria 584
119 Ga0451577_0002754 3300042876 Bacteria 20366
120 Ga0451577_0223455 3300042876 Bacteria 1702
121 Ga0451577_0860456 3300042876 Unclassified 817
122 Ga0453684_0011042 3300044712 Bacteria 15260
123 Ga0453684_0352378 3300044712 Bacteria 1659
124 Ga0453684_0829725 3300044712 Bacteria 995
125 Ga0451576_0654138 3300045051 Bacteria 1104
126 Ga0451576_0655071 3300045051 Bacteria 1103
127 Ga0451576_0863534 3300045051 Bacteria 950
128 Ga0451576_0916835 3300045051 Bacteria 919
129 Ga0495592_0000035 3300046454 Bacteria 125802
130 Ga0495641_0026784 3300046461 Unclassified 2810
131 Ga0495582_0036815 3300046473 Unclassified 2692
132 Ga0495582_0461434 3300046473 Bacteria 734
133 Ga0495639_0061368 3300046475 Unclassified 1724
134 Ga0495662_0004793 3300046476 Bacteria 6779
135 Ga0495618_0274341 3300046514 Bacteria 1053
136 Ga0495618_0528141 3300046514 Bacteria 709
137 Ga0495628_0007366 3300046516 Bacteria 9523
138 Ga0495630_0011204 3300046517 Bacteria 6488
139 Ga0495630_0068891 3300046517 Bacteria 2661
140 Ga0495666_0285974 3300046526 Bacteria 747
141 Ga0495652_0102251 3300046529 Unclassified 2322
142 Ga0495640_0548368 3300046533 Unclassified 701
143 Ga0495586_0002835 3300046535 Bacteria 9364
144 Ga0495586_0003202 3300046535 Bacteria 8798
145 Ga0495645_0016990 3300046543 Bacteria 5208
146 Ga0495645_0477013 3300046543 Bacteria 783
147 Ga0495667_1020416 3300046559 Unclassified 504
148 Ga0495634_0030104 3300046642 Unclassified 3752
149 Ga0495634_0305271 3300046642 Unclassified 961
150 Ga0495599_0003583 3300046678 Bacteria 9105
151 Ga0495599_0005777 3300046678 Bacteria 7425
152 Ga0495647_0043157 3300046681 Unclassified 1724
153 Ga0495613_0014521 3300046689 Bacteria 5843
154 Ga0495624_0877837 3300046690 Unclassified 528
155 Ga0495581_0192544 3300047315 Unclassified 1193
156 Ga0495674_0276330 3300047319 Unclassified 1377
157 Ga0495674_0345895 3300047319 Unclassified 1208
158 Ga0495677_0168032 3300047445 Unclassified 848
159 Ga0495684_0535844 3300047471 Bacteria 799
160 Ga0496115_1418193 3300048918 Bacteria 512
161 Ga0501236_088212 3300049670 Unclassified 592
162 Ga0501250_083361 3300049680 Unclassified 547
163 nmdc:mga09592_1355492_c1 3300050508 Bacteria 583
164 nmdc:mga08y16_2070072_c1 3300050511 Unclassified 517
165 nmdc:mga0rr50_1359151_c1 3300050513 Unclassified 602
166 nmdc:mga08x19_942681_c1 3300050514 Unclassified 613
167 Ga0157374_10143557
168 Ga0070683_101418814
169 Ga0070683_101951473
170 Ga0070690_100000306
171 Ga0070670_100557287
172 Ga0070677_10304904
173 Ga0068868_100263474
174 Ga0070668_100080907
175 Ga0070688_100090977
176 Ga0070688_101205442
177 Ga0070659_102088068
178 Ga0070713_101651259
179 Ga0070710_10893464
180 Ga0070700_100493495
181 Ga0068867_101823006
182 Ga0070685_10194297
183 Ga0070685_10907360
184 Ga0070672_101708674
185 Ga0070686_100004755
186 Ga0070686_100502353
187 Ga0070702_100552248
188 Ga0068852_101650755
189 Ga0068859_101614578
190 Ga0068864_100301056
191 Ga0068863_101667578
192 Ga0068862_100747765
193 Ga0068862_100777860
194 Ga0070717_11098380
195 Ga0097621_100062237
196 Ga0068871_100033827
197 Ga0068871_100721902
198 Ga0068871_101871833
199 Ga0075428_101408387
200 Ga0075430_100044104
201 Ga0075429_100143671
202 Ga0075429_101515654
203 Ga0068865_100862139
204 Ga0068865_100866312
205 Ga0097620_101614191
206 Ga0075435_101322750
207 Ga0075435_101442759
208 Ga0105240_10697954
209 Ga0111539_10460982
210 Ga0111539_10822486
211 Ga0111539_12165573
212 Ga0105248_11180179
213 Ga0105249_12390970
214 Ga0105239_12055267
215 Ga0105246_12289838
216 Ga0157371_10227905
217 Ga0157374_10090980
218 Ga0157378_10527749
219 Ga0157378_11125572
220 Ga0163162_10178168
221 Ga0163162_11722851
222 Ga0157372_10908984
223 Ga0157372_11123000
224 Ga0157372_11907018
225 Ga0157375_11829452
226 Ga0157375_13069107
227 Ga0157375_13697189
228 Ga0163163_12538410
229 Ga0157380_11457792
230 Ga0157380_12188472
231 Ga0157380_12314120
232 Ga0157379_10882951
233 Ga0157376_10028679
234 Ga0157376_10528189
235 Ga0157376_10641001
236 Ga0157376_10871292
237 Ga0157376_12282177
238 Ga0157376_12333748
239 Ga0207692_10391176
240 Ga0207663_11588108
241 Ga0207662_10592431
242 Ga0207700_10521681
243 Ga0207686_10612443
244 Ga0207670_10010071
245 Ga0207670_11126541
246 Ga0207704_11116332
247 Ga0207661_11038423
248 Ga0207668_11406117
249 Ga0207677_10406089
250 Ga0207708_10404912
251 Ga0207708_10559076
252 Ga0207641_10121576
253 Ga0207675_102008177
254 Ga0268266_11043136
255 Ga0268266_12176003
256 Ga0265338_10832265
257 Ga0265338_11131077
258 Ga0265330_10368695
259 Ga0265332_10040741
260 Ga0265328_10037992
261 Ga0265325_10394941
262 Ga0265329_10000531
263 Ga0265331_10254461
264 Ga0265327_10014515
265 Ga0265316_10103791
266 Ga0307408_100266225
267 Ga0265314_10000297
268 Ga0307413_10746104
269 Ga0307410_10895100
270 Ga0307406_10553873
271 Ga0307412_10152954
272 Ga0307416_101453215
273 Ga0307411_10112175
274 Ga0373936_0187721
275 Ga0373935_1002109
276 Ga0373927_0080226
277 Ga0373947_0840177
278 Ga0373947_1156933
279 Ga0373925_0002345
280 Ga0373925_1242173
281 Ga0395900_1718511
282 Ga0395905_0273833
283 Ga0395905_1798320
284 Ga0395901_1692396
285 Ga0451577_0002754
286 Ga0451577_0223455
287 Ga0451577_0860456
288 Ga0453684_0011042
289 Ga0453684_0352378
290 Ga0453684_0829725
291 Ga0451576_0654138
292 Ga0451576_0655071
293 Ga0451576_0863534
294 Ga0451576_0916835
295 Ga0495592_0000035
296 Ga0495641_0026784
297 Ga0495582_0036815
298 Ga0495582_0461434
299 Ga0495639_0061368
300 Ga0495662_0004793
301 Ga0495618_0274341
302 Ga0495618_0528141
303 Ga0495628_0007366
304 Ga0495630_0011204
305 Ga0495630_0068891
306 Ga0495666_0285974
307 Ga0495652_0102251
308 Ga0495640_0548368
309 Ga0495586_0002835
310 Ga0495586_0003202
311 Ga0495645_0016990
312 Ga0495645_0477013
313 Ga0495667_1020416
314 Ga0495634_0030104
315 Ga0495634_0305271
316 Ga0495599_0003583
317 Ga0495599_0005777
318 Ga0495647_0043157
319 Ga0495613_0014521
320 Ga0495624_0877837
321 Ga0495581_0192544
322 Ga0495674_0276330
323 Ga0495674_0345895
324 Ga0495677_0168032
325 Ga0495684_0535844
326 Ga0496115_1418193
327 Ga0501236_088212
328 Ga0501250_083361
329 nmdc:mga09592_1355492_c1
330 nmdc:mga08y16_2070072_c1
331 nmdc:mga0rr50_1359151_c1
332 nmdc:mga08x19_942681_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09723

Zn-ribbon_8

Zinc ribbon domain

14

58

0.96

Map