F247971

General Info

Members Datasets Scaffolds Average Seq Length
166 148 332 225

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100038754|Ga0070665_1000387545
Length 217
Sequence MLFKTVRMPSKEEALPGRPKPAFAVAPVHTVTGRPMVPPFPAGSAFAMFAMGCFWGAEKKFWSLPGVVSTNVGYAAGFTPNPTYREVCSGETGHTEVVRVIFDPTRISFDDLLRTFWENHDPTQGMRQGNDVGTQYRSGIYTFDAEQRQAAETSRAAYQKKLRDAGYGDITTEIQDAGEFYYAEDYHQQYLDKNPDGYCGLGGTGVACPVGLATRSS

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
7 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
8 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
9 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
10 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
11 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
16 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
17 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
18 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
19 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
20 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
21 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
22 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
23 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
24 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
25 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
26 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
27 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
28 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
29 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
30 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
31 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
32 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
33 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
34 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
35 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
36 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
37 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
38 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
39 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
40 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
41 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
42 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
43 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
44 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
45 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
46 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
47 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
48 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
49 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
50 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
51 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
52 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
53 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
54 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
55 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
56 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
57 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
58 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
59 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
60 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
61 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
62 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
63 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
64 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
65 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
66 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
67 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
68 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
69 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
77 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
78 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
79 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
82 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
83 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
84 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
85 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
86 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
87 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
88 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
89 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
90 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
91 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
92 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
93 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
94 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
95 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
96 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
97 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
98 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
99 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
100 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
101 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
102 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
103 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
104 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
105 2643221548 Streptomyces sp. Root55 Isolate Unclassified
106 2643221578 Streptomyces sp. Root63 Isolate Unclassified
107 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
108 2643221647 Streptomyces sp. Root369 Isolate Unclassified
109 2643221670 Streptomyces sp. Root431 Isolate Unclassified
110 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
111 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
112 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
113 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
114 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
115 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
116 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
117 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
118 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
119 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
120 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
121 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
122 2862574272 Streptomyces sp. AcE210 Isolate Nodule
123 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
124 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
125 2867369537 Streptomyces sp. Z26 Isolate Unclassified
126 2867475112 Streptomyces sp. TM32 Isolate Unclassified
127 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
128 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
129 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
130 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
131 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
132 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
133 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
134 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
135 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
136 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
137 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
138 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
139 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
140 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
141 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
142 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
143 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
144 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
145 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
146 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
147 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
148 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.08
Metatranscriptomes 0.6
Isolates 28.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.66
Nodule 0.6
Rhizoplane 1.2
Rhizosphere 61.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100038754 3300005548 Bacteria 4791
2 rootH1_10096623 3300003316 Bacteria 1394
3 rootH2_10126116 3300003320 Bacteria 2784
4 JGI25160J50197_1005589 3300003354 Bacteria 5207
5 JGI25160J50197_1006401 3300003354 Bacteria 4770
6 Ga0006562J51391_1189207 3300003578 Bacteria 5360
7 Ga0075430_100321060 3300006846 Bacteria 1280
8 Ga0075429_100042143 3300006880 Bacteria 3973
9 Ga0213875_10098676 3300021388 Bacteria 1363
10 Ga0209758_1004582 3300025297 Bacteria 11389
11 Ga0207426_1003232 3300025302 Bacteria 9141
12 Ga0207426_1014148 3300025302 Bacteria 2932
13 Ga0207426_1038086 3300025302 Bacteria 1516
14 Ga0207426_1047378 3300025302 Bacteria 1297
15 Ga0207657_10049750 3300025919 Bacteria 3649
16 Ga0207661_10919706 3300025944 Bacteria 806
17 Ga0268266_10036790 3300028379 Bacteria 4170
18 Ga0268264_10614426 3300028381 Bacteria 1072
19 Ga0307508_10006039 3300031616 Bacteria 11428
20 Ga0307508_10012269 3300031616 Bacteria 7835
21 Ga0307514_10154928 3300031649 Bacteria 1530
22 Ga0307514_10165550 3300031649 Bacteria 1455
23 Ga0307516_10012468 3300031730 Bacteria 9158
24 Ga0307416_100098810 3300032002 Bacteria 2533
25 Ga0307414_10209229 3300032004 Bacteria 1593
26 Ga0307507_10033434 3300033179 Bacteria 5339
27 Ga0436364_0875189 3300037853 Bacteria 6432
28 Ga0436365_1697981 3300039437 Bacteria 1426
29 Ga0439439_0002836 3300041406 Bacteria 3745
30 Ga0439433_0041651 3300041999 Bacteria 1070
31 Ga0439449_0042673 3300042007 Bacteria 1684
32 Ga0466965_0008577 3300044683 Bacteria 4730
33 Ga0466961_0018193 3300044693 Bacteria 4517
34 Ga0466963_0009288 3300044694 Bacteria 5921
35 Ga0466964_0018045 3300044706 Bacteria 2704
36 Ga0466971_0007921 3300044719 Bacteria 4628
37 Ga0466970_0007658 3300044765 Bacteria 5414
38 Ga0466957_0035840 3300044842 Bacteria 2978
39 Ga0466959_0046849 3300045049 Bacteria 3181
40 Ga0466958_0000955 3300045836 Bacteria 13063
41 Ga0466967_0066801 3300045976 Bacteria 3205
42 Ga0495592_0036499 3300046454 Bacteria 3701
43 Ga0495603_0000922 3300046455 Bacteria 16875
44 Ga0495629_0000966 3300046459 Bacteria 23190
45 Ga0495629_0074695 3300046459 Bacteria 2366
46 Ga0495651_0003756 3300046462 Bacteria 11616
47 Ga0495662_0006217 3300046476 Bacteria 5970
48 Ga0495664_0005485 3300046477 Bacteria 6965
49 Ga0495618_0011909 3300046514 Bacteria 5278
50 Ga0495628_0113859 3300046516 Bacteria 2079
51 Ga0495643_0005495 3300046522 Bacteria 8554
52 Ga0495666_0100454 3300046526 Bacteria 1363
53 Ga0495652_0041294 3300046529 Bacteria 3983
54 Ga0495586_0076183 3300046535 Bacteria 1838
55 Ga0495587_0009979 3300046536 Bacteria 6063
56 Ga0495667_0129356 3300046559 Bacteria 1629
57 Ga0495634_0003419 3300046642 Bacteria 12749
58 Ga0495635_0000821 3300046663 Bacteria 20349
59 Ga0495599_0176672 3300046678 Bacteria 1317
60 Ga0495646_0001244 3300046680 Bacteria 14953
61 Ga0495613_0001045 3300046689 Bacteria 21102
62 Ga0495613_0002299 3300046689 Bacteria 14474
63 Ga0495670_0007356 3300046691 Bacteria 5411
64 Ga0495649_0174428 3300046694 Bacteria 1124
65 Ga0495604_0001750 3300047317 Bacteria 17747
66 Ga0495674_0392552 3300047319 Bacteria 1121
67 Ga0495676_0003436 3300047321 Bacteria 14323
68 Ga0495676_0007684 3300047321 Bacteria 9890
69 Ga0495685_000207 3300047447 Bacteria 19805
70 Ga0495685_013437 3300047447 Bacteria 2780
71 Ga0495681_0001918 3300047470 Bacteria 15248
72 Ga0495684_0124886 3300047471 Bacteria 1936
73 Ga0495593_0002893 3300047673 Bacteria 10348
74 Ga0495602_0044429 3300048088 Bacteria 4030
75 Ga0495614_0000214 3300048089 Bacteria 22436
76 Ga0495614_0019246 3300048089 Bacteria 2954
77 Ga0496111_0060054 3300048914 Bacteria 2755
78 Ga0496123_0000673 3300048926 Bacteria 56422
79 Ga0496124_0089438 3300048927 Bacteria 2514
80 Ga0501032_0020938 3300049569 Bacteria 4550
81 Ga0501033_0056037 3300049570 Bacteria 2914
82 Ga0501034_0758679 3300049571 Bacteria 865
83 Ga0501036_0007460 3300049572 Bacteria 8914
84 Ga0501038_0035390 3300049574 Bacteria 4384
85 Ga0501038_0084342 3300049574 Bacteria 2673
86 Ga0501043_0012836 3300049579 Bacteria 6547
87 Ga0501043_0028612 3300049579 Bacteria 4374
88 Ga0501047_0041791 3300049581 Bacteria 4429
89 Ga0501070_0022689 3300049586 Bacteria 5256
90 Ga0501070_0328332 3300049586 Bacteria 1244
91 Ga0501235_020338 3300049669 Bacteria 1474
92 Ga0501282_000982 3300049778 Bacteria 3229
93 Ga0501035_0028684 3300049822 Bacteria 5078
94 Ga0501035_0095859 3300049822 Bacteria 2607
95 Ga0501044_0022086 3300049823 Bacteria 6785
96 Ga0501044_0117721 3300049823 Bacteria 2660
97 Ga0501045_0048423 3300049824 Bacteria 3099
98 nmdc:mga09592_77088_c1 3300050508 Bacteria 2835
99 Ga0495655_0004614 3300053083 Bacteria 2370
100 Ga0500578_0006693 3300053086 Bacteria 7664
101 Ga0500651_0279289 3300053093 Bacteria 964
102 Ga0500640_022554 3300053095 Bacteria 2722
103 Ga0500660_110735 3300053100 Bacteria 1171
104 Ga0500553_049069 3300053101 Bacteria 2031
105 Ga0500560_012374 3300053107 Bacteria 2209
106 Ga0500569_000728 3300053109 Bacteria 5723
107 Ga0500572_024610 3300053111 Bacteria 1626
108 Ga0500652_002984 3300053131 Bacteria 5105
109 Ga0500658_0037802 3300053134 Bacteria 1921
110 Ga0500561_0000470 3300053137 Bacteria 6569
111 Ga0500573_0068966 3300053140 Bacteria 2018
112 Ga0500573_0093742 3300053140 Bacteria 1694
113 Ga0500573_0132047 3300053140 Bacteria 1382
114 Ga0500600_0013872 3300053149 Bacteria 4897
115 Ga0500616_0020894 3300053153 Bacteria 3675
116 Ga0500624_006709 3300053157 Bacteria 1565
117 Ga0500634_0003480 3300053161 Bacteria 7014
118 Ga0500587_005805 3300053739 Bacteria 1651
119 Ga0466962_0005741 3300061719 Bacteria 5961
120 2554256558 2554235005 Bacteria 6457341
121 2585296165 2582581312 Bacteria 7308206
122 2616900348 2616644941 Bacteria 8510691
123 2643763636 2643221548 Bacteria 8053412
124 2643903191 2643221578 Bacteria 9213798
125 2643941745 2643221587 Bacteria 7586415
126 2644261279 2643221647 Bacteria 10741251
127 2644386480 2643221670 Bacteria 6497041
128 2644404298 2643221673 Bacteria 9196637
129 2644428828 2643221677 Bacteria 7584031
130 2644461929 2643221682 Bacteria 6743283
131 2768646505 2767802112 Bacteria 6465194
132 2785371086 2784746768 Bacteria 10036182
133 2793983431 2791355406 Bacteria 11364898
134 2808913191 2808606375 Bacteria 9466072
135 2811844827 2808606982 Bacteria 7791042
136 2819695007 2818991463 Bacteria 7948711
137 2852640250 2852635781 Bacteria 8251373
138 2862185072 2862178590 Bacteria 8583590
139 2862290964 2862290372 Bacteria 7471434
140 2862577908 2862574272 Bacteria 10567477
141 2862708580 2862705112 Bacteria 6563286
142 2867350226 2867346516 Bacteria 7608576
143 2867373438 2867369537 Bacteria 6501581
144 2867475664 2867475112 Bacteria 6909112
145 2873154466 2873151551 Bacteria 8625867
146 2875396269 2875391855 Bacteria 7600475
147 2877679501 2877676314 Bacteria 9512378
148 2918506076 2918501144 Bacteria 8668083
149 2935391738 2935390628 Bacteria 7043367
150 2946048329 2946045630 Bacteria 8527308
151 2966601236 2966598605 Bacteria 7676064
152 2997453431 2997451912 Bacteria 8492419
153 2997601060 2997600082 Bacteria 9896405
154 3006429628 3006425503 Bacteria 6491253
155 3006492072 3006486233 Bacteria 8157040
156 8008491330 8008485437 Bacteria 7198341
157 8025484899 8025478263 Bacteria 8209203
158 8025530659 8025524527 Bacteria 7197316
159 8033685653 8033684223 Bacteria 6906479
160 8047896555 8047893842 Bacteria 11723082
161 8048135246 8048127548 Bacteria 11053136
162 8048362380 8048356638 Bacteria 11044339
163 8048373569 8048369669 Bacteria 11666822
164 8048384673 8048379754 Bacteria 11877923
165 8054166526 8054160619 Bacteria 7783213
166 8056670698 8056667051 Bacteria 6953971
167 Ga0070665_100038754
168 rootH1_10096623
169 rootH2_10126116
170 JGI25160J50197_1005589
171 JGI25160J50197_1006401
172 Ga0006562J51391_1189207
173 Ga0075430_100321060
174 Ga0075429_100042143
175 Ga0213875_10098676
176 Ga0209758_1004582
177 Ga0207426_1003232
178 Ga0207426_1014148
179 Ga0207426_1038086
180 Ga0207426_1047378
181 Ga0207657_10049750
182 Ga0207661_10919706
183 Ga0268266_10036790
184 Ga0268264_10614426
185 Ga0307508_10006039
186 Ga0307508_10012269
187 Ga0307514_10154928
188 Ga0307514_10165550
189 Ga0307516_10012468
190 Ga0307416_100098810
191 Ga0307414_10209229
192 Ga0307507_10033434
193 Ga0436364_0875189
194 Ga0436365_1697981
195 Ga0439439_0002836
196 Ga0439433_0041651
197 Ga0439449_0042673
198 Ga0466965_0008577
199 Ga0466961_0018193
200 Ga0466963_0009288
201 Ga0466964_0018045
202 Ga0466971_0007921
203 Ga0466970_0007658
204 Ga0466957_0035840
205 Ga0466959_0046849
206 Ga0466958_0000955
207 Ga0466967_0066801
208 Ga0495592_0036499
209 Ga0495603_0000922
210 Ga0495629_0000966
211 Ga0495629_0074695
212 Ga0495651_0003756
213 Ga0495662_0006217
214 Ga0495664_0005485
215 Ga0495618_0011909
216 Ga0495628_0113859
217 Ga0495643_0005495
218 Ga0495666_0100454
219 Ga0495652_0041294
220 Ga0495586_0076183
221 Ga0495587_0009979
222 Ga0495667_0129356
223 Ga0495634_0003419
224 Ga0495635_0000821
225 Ga0495599_0176672
226 Ga0495646_0001244
227 Ga0495613_0001045
228 Ga0495613_0002299
229 Ga0495670_0007356
230 Ga0495649_0174428
231 Ga0495604_0001750
232 Ga0495674_0392552
233 Ga0495676_0003436
234 Ga0495676_0007684
235 Ga0495685_000207
236 Ga0495685_013437
237 Ga0495681_0001918
238 Ga0495684_0124886
239 Ga0495593_0002893
240 Ga0495602_0044429
241 Ga0495614_0000214
242 Ga0495614_0019246
243 Ga0496111_0060054
244 Ga0496123_0000673
245 Ga0496124_0089438
246 Ga0501032_0020938
247 Ga0501033_0056037
248 Ga0501034_0758679
249 Ga0501036_0007460
250 Ga0501038_0035390
251 Ga0501038_0084342
252 Ga0501043_0012836
253 Ga0501043_0028612
254 Ga0501047_0041791
255 Ga0501070_0022689
256 Ga0501070_0328332
257 Ga0501235_020338
258 Ga0501282_000982
259 Ga0501035_0028684
260 Ga0501035_0095859
261 Ga0501044_0022086
262 Ga0501044_0117721
263 Ga0501045_0048423
264 nmdc:mga09592_77088_c1
265 Ga0495655_0004614
266 Ga0500578_0006693
267 Ga0500651_0279289
268 Ga0500640_022554
269 Ga0500660_110735
270 Ga0500553_049069
271 Ga0500560_012374
272 Ga0500569_000728
273 Ga0500572_024610
274 Ga0500652_002984
275 Ga0500658_0037802
276 Ga0500561_0000470
277 Ga0500573_0068966
278 Ga0500573_0093742
279 Ga0500573_0132047
280 Ga0500600_0013872
281 Ga0500616_0020894
282 Ga0500624_006709
283 Ga0500634_0003480
284 Ga0500587_005805
285 Ga0466962_0005741
286 2554256558
287 2585296165
288 2616900348
289 2643763636
290 2643903191
291 2643941745
292 2644261279
293 2644386480
294 2644404298
295 2644428828
296 2644461929
297 2768646505
298 2785371086
299 2793983431
300 2808913191
301 2811844827
302 2819695007
303 2852640250
304 2862185072
305 2862290964
306 2862577908
307 2862708580
308 2867350226
309 2867373438
310 2867475664
311 2873154466
312 2875396269
313 2877679501
314 2918506076
315 2935391738
316 2946048329
317 2966601236
318 2997453431
319 2997601060
320 3006429628
321 3006492072
322 8008491330
323 8025484899
324 8025530659
325 8033685653
326 8047896555
327 8048135246
328 8048362380
329 8048373569
330 8048384673
331 8054166526
332 8056670698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

46

200

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.9603 11 213
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9577 8 201
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9528 8 201
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.9463 11 213
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9428 9 196
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9426 46 197 3.30.1060.10
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9408 9 199 3.30.1060.10
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9331 44 199 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.924 46 197 3.30.1060.10
3e0mA01 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9098 46 206 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A451CNZ6-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9649 14 213 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-F1R878-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.9631 8 213 GO:0005737
GO:0008113
GO:0016020
GO:0034599
GO:0036456
AF-A0A2D5CGW7-F1-model_v4 deleted 0.9624 7 201
AF-A0A534EGE6-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.962 7 213 GO:0005737
GO:0008113
GO:0034599
GO:0036211
GO:0036456
AF-A0A226MYB4-F1-model_v4 YTH domain-containing family protein 0.9611 7 212 GO:0000932
GO:0003729
GO:0005634
GO:0005829
GO:0008113
GO:0010494
GO:0061157
GO:1990247

Map