F247694

General Info

Members Datasets Scaffolds Average Seq Length
166 130 332 230

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100593827|Ga0070682_1005938271
Length 265
Sequence MVDMDGHAVTPALSDGPFGPRLEHTRQTAVVTGASAGLGRALARLLAQDGWRLVIDARRAEPLAAVQRELAQLTDIAAVPGDIADHEHRSALVRATAGRIDLLINNASDLGASPLPALRDLTGTARNRLWQVNVDAPLVLIQMALPILAPGAVVINISSDAAAEHYENWGGYGASKAALDHLTLTLAAEEPQHRFYAVDPGDMRTEMHQAAFPGEDISDRPEPESVAPRLVALARSGMPSGRYRAVDLPDPSTATSGLDRKPSHR

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
59 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
62 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
63 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
64 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
65 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
66 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
67 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
68 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
71 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
72 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
75 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
76 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
77 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
78 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
79 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
80 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
81 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
84 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
85 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
89 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
90 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
106 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
107 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
118 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
124 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
125 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
126 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
127 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
128 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
129 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
130 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.78
Metatranscriptomes 1.2
Isolates 3.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0.6
Rhizoplane 10.84
Rhizosphere 82.53
Stem 0
Stem Tuber 0
Unclassified 1.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100593827 3300005337 Unclassified 873
2 Ga0070683_100832939 3300005329 Bacteria 885
3 Ga0070677_10149903 3300005333 Bacteria 1084
4 Ga0068868_100432417 3300005338 Bacteria 1141
5 Ga0070689_100269400 3300005340 Bacteria 1409
6 Ga0070661_100206547 3300005344 Bacteria 1502
7 Ga0070714_100000906 3300005435 Bacteria 20969
8 Ga0070714_100077374 3300005435 Bacteria 2889
9 Ga0070700_100000077 3300005441 Bacteria 66494
10 Ga0070663_100144759 3300005455 Bacteria 1817
11 Ga0068867_100020257 3300005459 Bacteria 4739
12 Ga0070679_100104775 3300005530 Bacteria 2815
13 Ga0070684_100410571 3300005535 Bacteria 1249
14 Ga0070686_100481197 3300005544 Bacteria 960
15 Ga0068855_100227189 3300005563 Bacteria 2091
16 Ga0070664_100021907 3300005564 Bacteria 5269
17 Ga0070664_100397387 3300005564 Bacteria 1260
18 Ga0068856_100070707 3300005614 Bacteria 3453
19 Ga0068856_100713797 3300005614 Bacteria 1023
20 Ga0068852_100791366 3300005616 Bacteria 962
21 Ga0068870_10411738 3300005840 Bacteria 882
22 Ga0081455_10002591 3300005937 Bacteria 21441
23 Ga0081455_10069031 3300005937 Bacteria 2940
24 Ga0081455_10086270 3300005937 Bacteria 2557
25 Ga0081538_10001198 3300005981 Bacteria 27247
26 Ga0081539_10093302 3300005985 Bacteria 1551
27 Ga0075363_100000368 3300006048 Bacteria 13580
28 Ga0105240_10145677 3300009093 Bacteria 2826
29 Ga0105245_10198699 3300009098 Bacteria 1925
30 Ga0105243_10069981 3300009148 Bacteria 2832
31 Ga0105248_10369964 3300009177 Bacteria 1614
32 Ga0105238_10068794 3300009551 Bacteria 3542
33 Ga0105238_10485109 3300009551 Bacteria 1236
34 Ga0105249_10062906 3300009553 Bacteria 3408
35 Ga0157378_10024920 3300013297 Bacteria 5268
36 Ga0157372_10000373 3300013307 Bacteria 49502
37 Ga0157372_10325470 3300013307 Bacteria 1790
38 Ga0157375_10070730 3300013308 Bacteria 3500
39 Ga0157375_11146755 3300013308 Bacteria 911
40 Ga0157379_10168428 3300014968 Bacteria 1978
41 Ga0206353_10034858 3300020082 Bacteria 8583
42 Ga0206353_10622742 3300020082 Bacteria 2143
43 Ga0207695_10289834 3300025913 Bacteria 1529
44 Ga0207660_10274224 3300025917 Bacteria 1337
45 Ga0207649_10050151 3300025920 Bacteria 2581
46 Ga0207652_10483765 3300025921 Bacteria 1115
47 Ga0207681_10383542 3300025923 Bacteria 1132
48 Ga0207694_10523679 3300025924 Bacteria 994
49 Ga0207687_10181976 3300025927 Bacteria 1629
50 Ga0207664_10000002 3300025929 Bacteria 657053
51 Ga0207670_10253319 3300025936 Bacteria 1362
52 Ga0207704_10435906 3300025938 Bacteria 1042
53 Ga0207661_10326168 3300025944 Bacteria 1381
54 Ga0207661_10381409 3300025944 Bacteria 1276
55 Ga0207679_10118518 3300025945 Bacteria 2103
56 Ga0207677_10280694 3300026023 Bacteria 1367
57 Ga0207678_10030572 3300026067 Bacteria 4700
58 Ga0207678_10453206 3300026067 Bacteria 1115
59 Ga0207678_10735344 3300026067 Bacteria 869
60 Ga0207708_10000032 3300026075 Bacteria 153949
61 Ga0207702_10209428 3300026078 Bacteria 1812
62 Ga0207648_10002835 3300026089 Bacteria 18384
63 Ga0207683_10199899 3300026121 Bacteria 1816
64 Ga0307410_10024145 3300031852 Bacteria 3794
65 Ga0307406_10559598 3300031901 Bacteria 937
66 Ga0307409_100035289 3300031995 Bacteria 3663
67 Ga0307409_100093422 3300031995 Bacteria 2472
68 Ga0307409_100099432 3300031995 Bacteria 2409
69 Ga0307416_100090626 3300032002 Bacteria 2623
70 Ga0307414_10140731 3300032004 Bacteria 1889
71 Ga0307415_100099674 3300032126 Bacteria 2127
72 Ga0373943_0071222 3300035170 Bacteria 1761
73 Ga0373927_0000794 3300035695 Bacteria 24092
74 Ga0373925_0020219 3300037068 Bacteria 4844
75 Ga0436365_1215062 3300039437 Bacteria 2420
76 Ga0451793_1272282 3300041452 Bacteria 3548
77 Ga0451833_0338014 3300041491 Bacteria 1845
78 Ga0451837_0317795 3300041494 Unclassified 2335
79 Ga0451843_1499978 3300041509 Bacteria 886
80 Ga0466969_0241592 3300044656 Bacteria 819
81 Ga0466966_0382335 3300044684 Bacteria 846
82 Ga0466961_0018939 3300044693 Bacteria 4430
83 Ga0466961_0055867 3300044693 Bacteria 2516
84 Ga0466963_0044581 3300044694 Bacteria 2919
85 Ga0466963_0048681 3300044694 Bacteria 2802
86 Ga0466970_0038447 3300044765 Bacteria 2538
87 Ga0466970_0045085 3300044765 Bacteria 2347
88 Ga0466957_0002611 3300044842 Bacteria 9710
89 Ga0466958_0007363 3300045836 Bacteria 6048
90 Ga0466958_0100706 3300045836 Bacteria 1796
91 Ga0466958_0193274 3300045836 Bacteria 1294
92 Ga0466967_0008682 3300045976 Bacteria 7477
93 Ga0495641_0142240 3300046461 Unclassified 1072
94 Ga0495651_0116907 3300046462 Bacteria 1964
95 Ga0495608_0078091 3300046511 Bacteria 2155
96 Ga0495658_0069318 3300046683 Bacteria 2044
97 Ga0495581_0158217 3300047315 Bacteria 1324
98 Ga0496101_0090139 3300048904 Bacteria 2280
99 Ga0496102_0002303 3300048905 Bacteria 16318
100 Ga0496103_0055441 3300048906 Bacteria 2458
101 Ga0496104_0145801 3300048907 Bacteria 2273
102 Ga0496106_0363343 3300048909 Bacteria 1163
103 Ga0496108_0088878 3300048911 Bacteria 2625
104 Ga0496109_0025640 3300048912 Bacteria 5255
105 Ga0496109_0615461 3300048912 Bacteria 1022
106 Ga0496109_0792362 3300048912 Bacteria 886
107 Ga0496110_0137412 3300048913 Bacteria 2209
108 Ga0496112_0116457 3300048915 Bacteria 2643
109 Ga0496112_0522706 3300048915 Bacteria 1121
110 Ga0496113_0614559 3300048916 Bacteria 870
111 Ga0496114_0004960 3300048917 Bacteria 10377
112 Ga0496114_0009097 3300048917 Bacteria 7875
113 Ga0496114_0046990 3300048917 Bacteria 3589
114 Ga0496114_0189120 3300048917 Bacteria 1801
115 Ga0501031_0000505 3300049568 Bacteria 22808
116 Ga0501031_0000868 3300049568 Bacteria 18195
117 Ga0501032_0001586 3300049569 Bacteria 18117
118 Ga0501033_0001897 3300049570 Bacteria 18179
119 Ga0501034_0006066 3300049571 Bacteria 13049
120 Ga0501036_0001217 3300049572 Bacteria 19673
121 Ga0501037_0000750 3300049573 Bacteria 24514
122 Ga0501038_0000873 3300049574 Bacteria 26691
123 Ga0501038_0020002 3300049574 Bacteria 6025
124 Ga0501039_0000620 3300049575 Bacteria 25663
125 Ga0501039_0006473 3300049575 Bacteria 8904
126 Ga0501039_0344898 3300049575 Bacteria 1170
127 Ga0501040_0030622 3300049576 Bacteria 3635
128 Ga0501041_0007439 3300049577 Bacteria 6432
129 Ga0501042_0002313 3300049578 Bacteria 11657
130 Ga0501042_0219084 3300049578 Bacteria 1373
131 Ga0501043_0000111 3300049579 Bacteria 76773
132 Ga0501043_0048390 3300049579 Bacteria 3343
133 Ga0501046_0000307 3300049580 Bacteria 49550
134 Ga0501047_0000289 3300049581 Bacteria 57793
135 Ga0501048_0000376 3300049582 Bacteria 30941
136 Ga0501048_0000946 3300049582 Bacteria 21465
137 Ga0501069_0002174 3300049585 Bacteria 9877
138 Ga0501070_0000909 3300049586 Bacteria 26947
139 Ga0501072_0095696 3300049588 Bacteria 2360
140 Ga0501074_0000374 3300049590 Bacteria 26435
141 Ga0501075_0274164 3300049591 Bacteria 1285
142 Ga0501076_0012436 3300049592 Bacteria 6362
143 Ga0501079_0039118 3300049741 Bacteria 3657
144 Ga0501080_0000125 3300049742 Bacteria 54161
145 Ga0501080_0049654 3300049742 Bacteria 3905
146 Ga0501081_0031273 3300049743 Bacteria 3607
147 Ga0501083_0016348 3300049744 Bacteria 5195
148 Ga0501083_0119431 3300049744 Bacteria 1730
149 Ga0501035_0000498 3300049822 Bacteria 44178
150 Ga0501035_0057936 3300049822 Bacteria 3453
151 Ga0501044_0003719 3300049823 Bacteria 17140
152 Ga0501045_0001268 3300049824 Bacteria 16749
153 nmdc:mga03n38_589_c1 3300050490 Bacteria 9229
154 nmdc:mga00v17_11215_c1 3300050491 Bacteria 4922
155 Ga0495601_0094611 3300053077 Bacteria 1926
156 Ga0495595_0044758 3300053084 Bacteria 2034
157 Ga0501084_0000705 3300054114 Bacteria 25579
158 Ga0501084_0008526 3300054114 Bacteria 8472
159 Ga0501082_0006595 3300060353 Bacteria 10044
160 Ga0466962_0008335 3300061719 Bacteria 4966
161 Ga0530510_0006731 3300061734 Bacteria 8010
162 2676495088 2675903060 Bacteria 10051191
163 2884694269 2884693830 Bacteria 11273186
164 2895435674 2895427314 Bacteria 13147766
165 2895444709 2895442618 Bacteria 11027144
166 8002782514 8002775197 Bacteria 10728764
167 Ga0070682_100593827
168 Ga0070683_100832939
169 Ga0070677_10149903
170 Ga0068868_100432417
171 Ga0070689_100269400
172 Ga0070661_100206547
173 Ga0070714_100000906
174 Ga0070714_100077374
175 Ga0070700_100000077
176 Ga0070663_100144759
177 Ga0068867_100020257
178 Ga0070679_100104775
179 Ga0070684_100410571
180 Ga0070686_100481197
181 Ga0068855_100227189
182 Ga0070664_100021907
183 Ga0070664_100397387
184 Ga0068856_100070707
185 Ga0068856_100713797
186 Ga0068852_100791366
187 Ga0068870_10411738
188 Ga0081455_10002591
189 Ga0081455_10069031
190 Ga0081455_10086270
191 Ga0081538_10001198
192 Ga0081539_10093302
193 Ga0075363_100000368
194 Ga0105240_10145677
195 Ga0105245_10198699
196 Ga0105243_10069981
197 Ga0105248_10369964
198 Ga0105238_10068794
199 Ga0105238_10485109
200 Ga0105249_10062906
201 Ga0157378_10024920
202 Ga0157372_10000373
203 Ga0157372_10325470
204 Ga0157375_10070730
205 Ga0157375_11146755
206 Ga0157379_10168428
207 Ga0206353_10034858
208 Ga0206353_10622742
209 Ga0207695_10289834
210 Ga0207660_10274224
211 Ga0207649_10050151
212 Ga0207652_10483765
213 Ga0207681_10383542
214 Ga0207694_10523679
215 Ga0207687_10181976
216 Ga0207664_10000002
217 Ga0207670_10253319
218 Ga0207704_10435906
219 Ga0207661_10326168
220 Ga0207661_10381409
221 Ga0207679_10118518
222 Ga0207677_10280694
223 Ga0207678_10030572
224 Ga0207678_10453206
225 Ga0207678_10735344
226 Ga0207708_10000032
227 Ga0207702_10209428
228 Ga0207648_10002835
229 Ga0207683_10199899
230 Ga0307410_10024145
231 Ga0307406_10559598
232 Ga0307409_100035289
233 Ga0307409_100093422
234 Ga0307409_100099432
235 Ga0307416_100090626
236 Ga0307414_10140731
237 Ga0307415_100099674
238 Ga0373943_0071222
239 Ga0373927_0000794
240 Ga0373925_0020219
241 Ga0436365_1215062
242 Ga0451793_1272282
243 Ga0451833_0338014
244 Ga0451837_0317795
245 Ga0451843_1499978
246 Ga0466969_0241592
247 Ga0466966_0382335
248 Ga0466961_0018939
249 Ga0466961_0055867
250 Ga0466963_0044581
251 Ga0466963_0048681
252 Ga0466970_0038447
253 Ga0466970_0045085
254 Ga0466957_0002611
255 Ga0466958_0007363
256 Ga0466958_0100706
257 Ga0466958_0193274
258 Ga0466967_0008682
259 Ga0495641_0142240
260 Ga0495651_0116907
261 Ga0495608_0078091
262 Ga0495658_0069318
263 Ga0495581_0158217
264 Ga0496101_0090139
265 Ga0496102_0002303
266 Ga0496103_0055441
267 Ga0496104_0145801
268 Ga0496106_0363343
269 Ga0496108_0088878
270 Ga0496109_0025640
271 Ga0496109_0615461
272 Ga0496109_0792362
273 Ga0496110_0137412
274 Ga0496112_0116457
275 Ga0496112_0522706
276 Ga0496113_0614559
277 Ga0496114_0004960
278 Ga0496114_0009097
279 Ga0496114_0046990
280 Ga0496114_0189120
281 Ga0501031_0000505
282 Ga0501031_0000868
283 Ga0501032_0001586
284 Ga0501033_0001897
285 Ga0501034_0006066
286 Ga0501036_0001217
287 Ga0501037_0000750
288 Ga0501038_0000873
289 Ga0501038_0020002
290 Ga0501039_0000620
291 Ga0501039_0006473
292 Ga0501039_0344898
293 Ga0501040_0030622
294 Ga0501041_0007439
295 Ga0501042_0002313
296 Ga0501042_0219084
297 Ga0501043_0000111
298 Ga0501043_0048390
299 Ga0501046_0000307
300 Ga0501047_0000289
301 Ga0501048_0000376
302 Ga0501048_0000946
303 Ga0501069_0002174
304 Ga0501070_0000909
305 Ga0501072_0095696
306 Ga0501074_0000374
307 Ga0501075_0274164
308 Ga0501076_0012436
309 Ga0501079_0039118
310 Ga0501080_0000125
311 Ga0501080_0049654
312 Ga0501081_0031273
313 Ga0501083_0016348
314 Ga0501083_0119431
315 Ga0501035_0000498
316 Ga0501035_0057936
317 Ga0501044_0003719
318 Ga0501045_0001268
319 nmdc:mga03n38_589_c1
320 nmdc:mga00v17_11215_c1
321 Ga0495601_0094611
322 Ga0495595_0044758
323 Ga0501084_0000705
324 Ga0501084_0008526
325 Ga0501082_0006595
326 Ga0466962_0008335
327 Ga0530510_0006731
328 2676495088
329 2884694269
330 2895435674
331 2895444709
332 8002782514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

27

216

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

33

236

0.87

PF08659

KR

KR domain

27

192

0.84

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

29

203

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bms-assembly2.cif.gz_E-2 short chain alcohol dehydrogenase from ralstonia sp. dsm 6428 in complex with nadph 0.8994 6 208
6ihi-assembly1.cif.gz_A crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.8936 6 208
4bms-assembly1.cif.gz_A short chain alcohol dehydrogenase from ralstonia sp. dsm 6428 in complex with nadph 0.8846 1 209
4bms-assembly1.cif.gz_B short chain alcohol dehydrogenase from ralstonia sp. dsm 6428 in complex with nadph 0.8839 1 208
4bms-assembly1.cif.gz_F short chain alcohol dehydrogenase from ralstonia sp. dsm 6428 in complex with nadph 0.8819 1 208
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9322 79 157 3.40.50.720
af_Q0E0D3_22_224_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9098 6 188 3.40.50.720
af_A0A0R0KD75_7_239_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9026 6 208 3.40.50.720
6b9uA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8923 7 208 3.40.50.720
af_C0P944_2_268_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8813 6 208 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6V8L3X4-F1-model_v4 Short-chain dehydrogenase 0.97 55 212 GO:0004757
GO:0005737
GO:0006729
AF-A0A428YXN4-F1-model_v4 Short-chain dehydrogenase 0.9663 6 208 GO:0016491
AF-A0A6I5X531-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9618 4 212 GO:0016491
AF-A0A7W7Q706-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9618 6 208 GO:0016020
GO:0016491
AF-D9XS22-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9586 63 217 GO:0050664

Map