F247478

General Info

Members Datasets Scaffolds Average Seq Length
166 107 332 173

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10221346|rootH2_102213461
Length 195
Sequence MRAPSRLPAADSLEKLEVMSTSAKMLVSVGEKCVCIKIAGRANFTSSIDFKTLVNELMQKGCTYFVLDLQECTLMDSTFLGVLAGFGLKVNAPQPDKQTRVIELYNPNARIADLLENLGVLHLFKVQQGDVCLPEPTAPHDHSPAAPSREEVTANCLEAHRTLMGINPENVARFKDVAAFLAEDLKKMKAGSPSS

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
43 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
44 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
45 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
46 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
47 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
57 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
58 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
59 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
60 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
61 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
62 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
63 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
64 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
75 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
88 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
97 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.2
Rhizosphere 98.19
Stem 0
Stem Tuber 0
Unclassified 30.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10221346 3300003320 Bacteria 1883
2 Ga0065707_10441636 3300005295 Unclassified 809
3 Ga0070689_100013341 3300005340 Bacteria 5943
4 Ga0070689_100371175 3300005340 Unclassified 1204
5 Ga0070687_100294954 3300005343 Bacteria 1026
6 Ga0070688_100301651 3300005365 Unclassified 1158
7 Ga0070714_100102271 3300005435 Bacteria 2526
8 Ga0070714_100560698 3300005435 Bacteria 1094
9 Ga0070711_100117151 3300005439 Bacteria 1964
10 Ga0070711_100458782 3300005439 Unclassified 1044
11 Ga0070694_100079566 3300005444 Bacteria 2276
12 Ga0068867_100755152 3300005459 Unclassified 863
13 Ga0070707_100740571 3300005468 Bacteria 946
14 Ga0070686_100009125 3300005544 Bacteria 5562
15 Ga0070686_100275614 3300005544 Bacteria 1238
16 Ga0070686_100930866 3300005544 Unclassified 709
17 Ga0068857_100003603 3300005577 Bacteria 12971
18 Ga0068859_100639318 3300005617 Unclassified 1156
19 Ga0068859_100793208 3300005617 Unclassified 1035
20 Ga0068863_100067640 3300005841 Unclassified 3379
21 Ga0068858_100749177 3300005842 Bacteria 952
22 Ga0081539_10214407 3300005985 Unclassified 880
23 Ga0070712_100118119 3300006175 Bacteria 1991
24 Ga0075431_100027160 3300006847 Bacteria 5871
25 Ga0097620_100639328 3300006931 Unclassified 1156
26 Ga0097620_100793280 3300006931 Unclassified 1035
27 Ga0097620_101052551 3300006931 Unclassified 894
28 Ga0075435_100740836 3300007076 Bacteria 855
29 Ga0105240_10002027 3300009093 Bacteria 33415
30 Ga0111539_10104100 3300009094 Bacteria 3331
31 Ga0114129_11187109 3300009147 Bacteria 951
32 Ga0105242_10155989 3300009176 Bacteria 1994
33 Ga0105248_11128626 3300009177 Unclassified 886
34 Ga0105249_10632072 3300009553 Unclassified 1127
35 Ga0157371_10436947 3300013102 Unclassified 961
36 Ga0157378_10495601 3300013297 Unclassified 1219
37 Ga0157372_10598896 3300013307 Bacteria 1285
38 Ga0157372_10639250 3300013307 Bacteria 1239
39 Ga0157375_11024501 3300013308 Unclassified 964
40 Ga0163163_10062477 3300014325 Unclassified 3690
41 Ga0157380_10921117 3300014326 Unclassified 902
42 Ga0157377_10720694 3300014745 Unclassified 726
43 Ga0157379_10541126 3300014968 Bacteria 1083
44 Ga0157376_11282811 3300014969 Bacteria 762
45 Ga0207695_10007847 3300025913 Bacteria 13492
46 Ga0207686_10233928 3300025934 Unclassified 1334
47 Ga0207670_10006806 3300025936 Bacteria 6359
48 Ga0207702_10491025 3300026078 Bacteria 1196
49 Ga0207641_10140589 3300026088 Unclassified 2178
50 Ga0207674_10008357 3300026116 Bacteria 11973
51 Ga0265337_1008406 3300028556 Bacteria 3757
52 Ga0265337_1018197 3300028556 Bacteria 2237
53 Ga0265337_1080795 3300028556 Bacteria 889
54 Ga0265337_1082620 3300028556 Unclassified 878
55 Ga0265326_10031407 3300028558 Bacteria 1513
56 Ga0265319_1013406 3300028563 Bacteria 3261
57 Ga0265319_1018615 3300028563 Bacteria 2611
58 Ga0265334_10020792 3300028573 Bacteria 2684
59 Ga0265334_10068837 3300028573 Unclassified 1321
60 Ga0265318_10025012 3300028577 Unclassified 2362
61 Ga0265323_10012035 3300028653 Bacteria 3476
62 Ga0265338_10000032 3300028800 Bacteria 257580
63 Ga0265338_10001496 3300028800 Bacteria 37847
64 Ga0265338_10005609 3300028800 Bacteria 16304
65 Ga0265338_10006578 3300028800 Bacteria 14748
66 Ga0265338_10011377 3300028800 Bacteria 10287
67 Ga0265338_10018228 3300028800 Bacteria 7524
68 Ga0265338_10041924 3300028800 Unclassified 4273
69 Ga0265338_10048957 3300028800 Bacteria 3837
70 Ga0265338_10199975 3300028800 Unclassified 1507
71 Ga0265338_10509922 3300028800 Unclassified 846
72 Ga0265324_10052140 3300029957 Unclassified 1405
73 Ga0265330_10072259 3300031235 Bacteria 1492
74 Ga0265320_10130972 3300031240 Unclassified 1139
75 Ga0265320_10289291 3300031240 Unclassified 725
76 Ga0265320_10324279 3300031240 Unclassified 681
77 Ga0265325_10027443 3300031241 Bacteria 3077
78 Ga0265325_10051169 3300031241 Bacteria 2124
79 Ga0265340_10038153 3300031247 Bacteria 2378
80 Ga0265339_10009023 3300031249 Bacteria 6299
81 Ga0265339_10060263 3300031249 Bacteria 2046
82 Ga0265316_10004788 3300031344 Bacteria 13352
83 Ga0265316_10018585 3300031344 Bacteria 5969
84 Ga0265316_10221742 3300031344 Unclassified 1395
85 Ga0265316_10389323 3300031344 Bacteria 1005
86 Ga0265313_10004126 3300031595 Bacteria 11296
87 Ga0265314_10037511 3300031711 Bacteria 3511
88 Ga0265342_10014782 3300031712 Bacteria 5169
89 Ga0316576_10231089 3300031727 Bacteria 1391
90 Ga0373934_0144447 3300035086 Bacteria 973
91 Ga0373953_0023377 3300035117 Bacteria 2339
92 Ga0373954_0085085 3300035118 Bacteria 1514
93 Ga0373954_0117041 3300035118 Bacteria 1292
94 Ga0373956_0001283 3300035119 Bacteria 10400
95 Ga0373956_0403412 3300035119 Bacteria 652
96 Ga0373946_0069044 3300035171 Bacteria 1521
97 Ga0373935_0548325 3300035692 Bacteria 842
98 Ga0373927_0013153 3300035695 Bacteria 5504
99 Ga0373933_0068847 3300035724 Bacteria 2150
100 Ga0373947_0188122 3300035725 Bacteria 1346
101 Ga0373937_0005321 3300036401 Bacteria 11001
102 Ga0316584_0151868 3300036712 Bacteria 1724
103 Ga0373925_0013839 3300037068 Bacteria 5841
104 Ga0373925_0287665 3300037068 Bacteria 1325
105 Ga0395905_0018463 3300037471 Bacteria 6619
106 Ga0395901_0254053 3300038443 Bacteria 1831
107 Ga0451789_0097497 3300041443 Unclassified 817
108 Ga0451800_0536659 3300041459 Unclassified 652
109 Ga0451577_0000024 3300042876 Bacteria 411758
110 Ga0451577_0001957 3300042876 Bacteria 25957
111 Ga0453684_0001566 3300044712 Bacteria 63428
112 Ga0453684_0015485 3300044712 Bacteria 12051
113 Ga0453684_0099018 3300044712 Bacteria 3573
114 Ga0453684_0648214 3300044712 Unclassified 1153
115 Ga0453684_2111104 3300044712 Unclassified 565
116 Ga0451576_0006381 3300045051 Bacteria 14480
117 Ga0451576_0439691 3300045051 Unclassified 1369
118 Ga0451576_0723229 3300045051 Bacteria 1046
119 Ga0451576_1112631 3300045051 Bacteria 826
120 Ga0451576_1734935 3300045051 Unclassified 646
121 Ga0495592_0460748 3300046454 Bacteria 795
122 Ga0495629_0560906 3300046459 Bacteria 766
123 Ga0495651_0452082 3300046462 Unclassified 830
124 Ga0495653_0465287 3300046463 Bacteria 793
125 Ga0495580_0491337 3300046472 Unclassified 820
126 Ga0495662_0021383 3300046476 Unclassified 3128
127 Ga0495618_0006156 3300046514 Bacteria 7278
128 Ga0495630_0000159 3300046517 Bacteria 52732
129 Ga0495630_0122794 3300046517 Bacteria 1970
130 Ga0495630_0292132 3300046517 Unclassified 1246
131 Ga0495666_0020108 3300046526 Bacteria 3312
132 Ga0495666_0048622 3300046526 Unclassified 2042
133 Ga0495666_0066247 3300046526 Bacteria 1722
134 Ga0495665_0147053 3300046531 Bacteria 1231
135 Ga0495640_0030974 3300046533 Bacteria 3824
136 Ga0495586_0000014 3300046535 Bacteria 131102
137 Ga0495586_0001775 3300046535 Bacteria 11786
138 Ga0495586_0003710 3300046535 Bacteria 8189
139 Ga0495587_0641487 3300046536 Unclassified 584
140 Ga0495645_0326358 3300046543 Bacteria 995
141 Ga0495645_0394971 3300046543 Bacteria 882
142 Ga0495645_0670335 3300046543 Bacteria 632
143 Ga0495667_0414188 3300046559 Bacteria 848
144 Ga0495634_0012037 3300046642 Bacteria 6271
145 Ga0495634_0017014 3300046642 Bacteria 5194
146 Ga0495634_0081242 3300046642 Bacteria 2120
147 Ga0495635_0061922 3300046663 Bacteria 2569
148 Ga0495599_0048864 3300046678 Unclassified 2652
149 Ga0495647_0012081 3300046681 Bacteria 2969
150 Ga0495658_0017808 3300046683 Bacteria 3679
151 Ga0495658_0122499 3300046683 Bacteria 1574
152 Ga0495613_0003333 3300046689 Bacteria 12013
153 Ga0495613_0018657 3300046689 Bacteria 5173
154 Ga0495613_0046128 3300046689 Unclassified 3223
155 Ga0495674_0026696 3300047319 Bacteria 5282
156 Ga0495674_0431384 3300047319 Bacteria 1061
157 Ga0495674_0742765 3300047319 Bacteria 767
158 Ga0495676_0002997 3300047321 Bacteria 15280
159 Ga0495676_0058898 3300047321 Bacteria 3020
160 Ga0495680_0007911 3300047322 Bacteria 9699
161 Ga0495684_0209492 3300047471 Unclassified 1434
162 Ga0495684_0521256 3300047471 Bacteria 814
163 Ga0501033_0278665 3300049570 Bacteria 1181
164 Ga0501034_0324876 3300049571 Unclassified 1471
165 Ga0501043_0111725 3300049579 Bacteria 2146
166 nmdc:mga08y16_305089_c1 3300050511 Unclassified 1640
167 rootH2_10221346
168 Ga0065707_10441636
169 Ga0070689_100013341
170 Ga0070689_100371175
171 Ga0070687_100294954
172 Ga0070688_100301651
173 Ga0070714_100102271
174 Ga0070714_100560698
175 Ga0070711_100117151
176 Ga0070711_100458782
177 Ga0070694_100079566
178 Ga0068867_100755152
179 Ga0070707_100740571
180 Ga0070686_100009125
181 Ga0070686_100275614
182 Ga0070686_100930866
183 Ga0068857_100003603
184 Ga0068859_100639318
185 Ga0068859_100793208
186 Ga0068863_100067640
187 Ga0068858_100749177
188 Ga0081539_10214407
189 Ga0070712_100118119
190 Ga0075431_100027160
191 Ga0097620_100639328
192 Ga0097620_100793280
193 Ga0097620_101052551
194 Ga0075435_100740836
195 Ga0105240_10002027
196 Ga0111539_10104100
197 Ga0114129_11187109
198 Ga0105242_10155989
199 Ga0105248_11128626
200 Ga0105249_10632072
201 Ga0157371_10436947
202 Ga0157378_10495601
203 Ga0157372_10598896
204 Ga0157372_10639250
205 Ga0157375_11024501
206 Ga0163163_10062477
207 Ga0157380_10921117
208 Ga0157377_10720694
209 Ga0157379_10541126
210 Ga0157376_11282811
211 Ga0207695_10007847
212 Ga0207686_10233928
213 Ga0207670_10006806
214 Ga0207702_10491025
215 Ga0207641_10140589
216 Ga0207674_10008357
217 Ga0265337_1008406
218 Ga0265337_1018197
219 Ga0265337_1080795
220 Ga0265337_1082620
221 Ga0265326_10031407
222 Ga0265319_1013406
223 Ga0265319_1018615
224 Ga0265334_10020792
225 Ga0265334_10068837
226 Ga0265318_10025012
227 Ga0265323_10012035
228 Ga0265338_10000032
229 Ga0265338_10001496
230 Ga0265338_10005609
231 Ga0265338_10006578
232 Ga0265338_10011377
233 Ga0265338_10018228
234 Ga0265338_10041924
235 Ga0265338_10048957
236 Ga0265338_10199975
237 Ga0265338_10509922
238 Ga0265324_10052140
239 Ga0265330_10072259
240 Ga0265320_10130972
241 Ga0265320_10289291
242 Ga0265320_10324279
243 Ga0265325_10027443
244 Ga0265325_10051169
245 Ga0265340_10038153
246 Ga0265339_10009023
247 Ga0265339_10060263
248 Ga0265316_10004788
249 Ga0265316_10018585
250 Ga0265316_10221742
251 Ga0265316_10389323
252 Ga0265313_10004126
253 Ga0265314_10037511
254 Ga0265342_10014782
255 Ga0316576_10231089
256 Ga0373934_0144447
257 Ga0373953_0023377
258 Ga0373954_0085085
259 Ga0373954_0117041
260 Ga0373956_0001283
261 Ga0373956_0403412
262 Ga0373946_0069044
263 Ga0373935_0548325
264 Ga0373927_0013153
265 Ga0373933_0068847
266 Ga0373947_0188122
267 Ga0373937_0005321
268 Ga0316584_0151868
269 Ga0373925_0013839
270 Ga0373925_0287665
271 Ga0395905_0018463
272 Ga0395901_0254053
273 Ga0451789_0097497
274 Ga0451800_0536659
275 Ga0451577_0000024
276 Ga0451577_0001957
277 Ga0453684_0001566
278 Ga0453684_0015485
279 Ga0453684_0099018
280 Ga0453684_0648214
281 Ga0453684_2111104
282 Ga0451576_0006381
283 Ga0451576_0439691
284 Ga0451576_0723229
285 Ga0451576_1112631
286 Ga0451576_1734935
287 Ga0495592_0460748
288 Ga0495629_0560906
289 Ga0495651_0452082
290 Ga0495653_0465287
291 Ga0495580_0491337
292 Ga0495662_0021383
293 Ga0495618_0006156
294 Ga0495630_0000159
295 Ga0495630_0122794
296 Ga0495630_0292132
297 Ga0495666_0020108
298 Ga0495666_0048622
299 Ga0495666_0066247
300 Ga0495665_0147053
301 Ga0495640_0030974
302 Ga0495586_0000014
303 Ga0495586_0001775
304 Ga0495586_0003710
305 Ga0495587_0641487
306 Ga0495645_0326358
307 Ga0495645_0394971
308 Ga0495645_0670335
309 Ga0495667_0414188
310 Ga0495634_0012037
311 Ga0495634_0017014
312 Ga0495634_0081242
313 Ga0495635_0061922
314 Ga0495599_0048864
315 Ga0495647_0012081
316 Ga0495658_0017808
317 Ga0495658_0122499
318 Ga0495613_0003333
319 Ga0495613_0018657
320 Ga0495613_0046128
321 Ga0495674_0026696
322 Ga0495674_0431384
323 Ga0495674_0742765
324 Ga0495676_0002997
325 Ga0495676_0058898
326 Ga0495680_0007911
327 Ga0495684_0209492
328 Ga0495684_0521256
329 Ga0501033_0278665
330 Ga0501034_0324876
331 Ga0501043_0111725
332 nmdc:mga08y16_305089_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

24

129

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yo5-assembly1.cif.gz_A eaec t6ss tssa-cterminus 0.9459 150 190
1til-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii 0.8916 22 130
1th8-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.8882 22 128
6m36-assembly1.cif.gz_H the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8812 22 127
3f43-assembly1.cif.gz_A-2 crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution 0.8744 27 127
ID Description Score Start End Superfamily
af_A0A1D6QMZ1_2_56_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8938 152 181 1.25.40.10
af_Q557B3_620_729_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8831 149 186 1.25.40.10
af_P60070_1_106_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8763 22 129 3.30.750.24
3f43A01 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8621 29 127 3.30.750.24
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8619 23 126 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A7V4MF68-F1-model_v4 STAS domain-containing protein 0.9437 22 195 GO:0016791
AF-A0A6C0GFY8-F1-model_v4 Anti-sigma factor antagonist 0.9288 24 129 GO:0043856
AF-A0A1X7AEH7-F1-model_v4 Anti-sigma factor antagonist 0.9267 22 129 GO:0043856
AF-A0A2E5WRS9-F1-model_v4 STAS domain-containing protein 0.9255 23 186
AF-A0A6I3SPU9-F1-model_v4 Anti-sigma factor antagonist 0.9225 25 126 GO:0043856

Map