F247299

General Info

Members Datasets Scaffolds Average Seq Length
165 99 330 90

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2847930680|2847932381
Length 110
Sequence VVEHFKNGDGLAVYSRMREKPTSGPGGELVPGKWKPSTCPEGLKVQGSWIEPSFNRCFQLMECDDLALFQKWILSASNDLIDFEIVPVRTAAETRELIAPYVDRAQFKRP

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
65 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
66 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
67 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
73 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
74 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
75 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
78 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
79 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
80 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
81 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
82 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
85 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
86 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
87 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
92 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
93 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
94 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
95 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
96 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
97 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
98 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
99 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.64
Rhizosphere 95.76
Stem 0
Stem Tuber 0
Unclassified 21.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10049380 3300005289 Unclassified 716
2 Ga0065704_10847908 3300005289 Unclassified 510
3 Ga0065715_10436954 3300005293 Unclassified 816
4 Ga0065707_10287578 3300005295 Bacteria 1032
5 Ga0065707_10577120 3300005295 Bacteria 699
6 Ga0070666_11172447 3300005335 Bacteria 572
7 Ga0070680_100569263 3300005336 Bacteria 971
8 Ga0070687_100860080 3300005343 Bacteria 647
9 Ga0070692_10000091 3300005345 Bacteria 19602
10 Ga0070669_102039874 3300005353 Unclassified 501
11 Ga0070709_10277906 3300005434 Bacteria 1216
12 Ga0070709_11009649 3300005434 Unclassified 662
13 Ga0070714_100772047 3300005435 Unclassified 930
14 Ga0070713_101851695 3300005436 Unclassified 585
15 Ga0070711_100150415 3300005439 Bacteria 1755
16 Ga0070711_101279285 3300005439 Unclassified 636
17 Ga0070705_100061910 3300005440 Bacteria 2226
18 Ga0070705_100191634 3300005440 Bacteria 1394
19 Ga0070694_100000304 3300005444 Bacteria 26348
20 Ga0070694_100900948 3300005444 Unclassified 730
21 Ga0070708_100013946 3300005445 Bacteria 6602
22 Ga0070708_100125935 3300005445 Bacteria 2368
23 Ga0070708_100538440 3300005445 Bacteria 1102
24 Ga0070708_101003019 3300005445 Bacteria 783
25 Ga0070708_101916558 3300005445 Bacteria 549
26 Ga0070706_100004214 3300005467 Bacteria 13959
27 Ga0070706_100032822 3300005467 Bacteria 4789
28 Ga0070706_100200056 3300005467 Bacteria 1866
29 Ga0070706_100309354 3300005467 Bacteria 1474
30 Ga0070706_100993635 3300005467 Bacteria 774
31 Ga0070706_101466099 3300005467 Bacteria 624
32 Ga0070707_100037179 3300005468 Bacteria 4646
33 Ga0070707_100141816 3300005468 Bacteria 2338
34 Ga0070707_100468435 3300005468 Bacteria 1221
35 Ga0070707_101530486 3300005468 Unclassified 634
36 Ga0070698_100406683 3300005471 Bacteria 1295
37 Ga0070698_100662916 3300005471 Bacteria 985
38 Ga0070698_100766675 3300005471 Bacteria 908
39 Ga0070699_100132623 3300005518 Bacteria 2196
40 Ga0070699_100998121 3300005518 Bacteria 767
41 Ga0070699_101624731 3300005518 Bacteria 592
42 Ga0070699_102050917 3300005518 Unclassified 523
43 Ga0070697_100018146 3300005536 Bacteria 5545
44 Ga0070697_100031981 3300005536 Bacteria 4233
45 Ga0070697_100179437 3300005536 Bacteria 1795
46 Ga0070697_100296162 3300005536 Bacteria 1390
47 Ga0070697_100888198 3300005536 Bacteria 790
48 Ga0070697_101009298 3300005536 Unclassified 740
49 Ga0070697_101273453 3300005536 Bacteria 656
50 Ga0070695_100341050 3300005545 Unclassified 1120
51 Ga0070695_100656714 3300005545 Unclassified 828
52 Ga0070696_100580497 3300005546 Unclassified 902
53 Ga0070696_100597561 3300005546 Unclassified 889
54 Ga0070704_100196253 3300005549 Unclassified 1626
55 Ga0070704_100557522 3300005549 Bacteria 1002
56 Ga0070704_101333053 3300005549 Bacteria 657
57 Ga0070664_100517693 3300005564 Bacteria 1101
58 Ga0070664_101953679 3300005564 Bacteria 557
59 Ga0068854_101358612 3300005578 Bacteria 641
60 Ga0068861_101240739 3300005719 Unclassified 722
61 Ga0068863_100970589 3300005841 Bacteria 852
62 Ga0068862_100974040 3300005844 Unclassified 837
63 Ga0081455_10023538 3300005937 Bacteria 5729
64 Ga0081455_10057061 3300005937 Bacteria 3311
65 Ga0070716_100112600 3300006173 Bacteria 1689
66 Ga0070712_100030729 3300006175 Bacteria 3614
67 Ga0070712_100655644 3300006175 Bacteria 892
68 Ga0070712_101410935 3300006175 Bacteria 608
69 Ga0097621_100039000 3300006237 Bacteria 3814
70 Ga0068871_100018711 3300006358 Bacteria 5274
71 Ga0068871_100241938 3300006358 Unclassified 1569
72 Ga0075428_101086329 3300006844 Bacteria 845
73 Ga0075430_100230958 3300006846 Bacteria 1534
74 Ga0075430_100524924 3300006846 Bacteria 977
75 Ga0075431_100011801 3300006847 Bacteria 8818
76 Ga0075431_100031627 3300006847 Bacteria 5450
77 Ga0075431_100264405 3300006847 Bacteria 1745
78 Ga0075431_100756964 3300006847 Bacteria 946
79 Ga0075433_10259930 3300006852 Bacteria 1539
80 Ga0075433_10490607 3300006852 Bacteria 1082
81 Ga0075434_100375959 3300006871 Bacteria 1442
82 Ga0075434_100556174 3300006871 Bacteria 1167
83 Ga0075429_100005528 3300006880 Bacteria 10885
84 Ga0075429_101726688 3300006880 Bacteria 543
85 Ga0075436_100021696 3300006914 Bacteria 4407
86 Ga0075436_100320953 3300006914 Bacteria 1113
87 Ga0075435_100801658 3300007076 Bacteria 820
88 Ga0099794_10714844 3300007265 Unclassified 534
89 Ga0111539_10464889 3300009094 Unclassified 1473
90 Ga0111539_13355059 3300009094 Unclassified 515
91 Ga0114129_10012722 3300009147 Bacteria 11978
92 Ga0114129_10794336 3300009147 Unclassified 1208
93 Ga0114129_10845693 3300009147 Bacteria 1164
94 Ga0114129_12465168 3300009147 Unclassified 622
95 Ga0114129_12767334 3300009147 Bacteria 584
96 Ga0105237_12214239 3300009545 Bacteria 559
97 Ga0157378_10010422 3300013297 Bacteria 8117
98 Ga0157378_11311158 3300013297 Bacteria 765
99 Ga0163163_11994849 3300014325 Bacteria 640
100 Ga0157376_10028543 3300014969 Unclassified 4436
101 Ga0157376_10065184 3300014969 Bacteria 3075
102 Ga0207680_11067571 3300025903 Unclassified 578
103 Ga0207684_10000740 3300025910 Bacteria 38281
104 Ga0207684_10081777 3300025910 Bacteria 2749
105 Ga0207684_10734194 3300025910 Bacteria 838
106 Ga0207684_10864211 3300025910 Bacteria 762
107 Ga0207693_10047291 3300025915 Bacteria 3380
108 Ga0207693_10094136 3300025915 Bacteria 2348
109 Ga0207663_10022897 3300025916 Bacteria 3576
110 Ga0207660_10238568 3300025917 Bacteria 1432
111 Ga0207646_10008309 3300025922 Bacteria 10418
112 Ga0207646_10332920 3300025922 Bacteria 1372
113 Ga0207681_11409280 3300025923 Unclassified 585
114 Ga0207659_11768656 3300025926 Unclassified 525
115 Ga0207700_11563091 3300025928 Unclassified 584
116 Ga0207664_10307186 3300025929 Bacteria 1397
117 Ga0207665_10295661 3300025939 Bacteria 1209
118 Ga0207665_10839106 3300025939 Unclassified 727
119 Ga0207679_10844603 3300025945 Bacteria 836
120 Ga0209974_10074016 3300027876 Bacteria 1165
121 Ga0265338_10001531 3300028800 Bacteria 37295
122 Ga0265324_10007892 3300029957 Bacteria 4270
123 Ga0265331_10249173 3300031250 Viruses 797
124 Ga0373949_0016269 3300035090 Bacteria 1667
125 Ga0373932_0127813 3300035112 Bacteria 854
126 Ga0373931_0236448 3300035691 Bacteria 1106
127 Ga0373935_1289031 3300035692 Bacteria 545
128 Ga0373925_0370141 3300037068 Bacteria 1166
129 Ga0451791_1285251 3300041451 Unclassified 595
130 Ga0451576_0246844 3300045051 Bacteria 1866
131 Ga0495590_0428339 3300046457 Bacteria 510
132 Ga0495580_0128841 3300046472 Bacteria 1756
133 Ga0495639_0053603 3300046475 Bacteria 1838
134 Ga0495664_0040444 3300046477 Bacteria 2757
135 Ga0495630_0027358 3300046517 Bacteria 4230
136 Ga0495586_0011121 3300046535 Bacteria 4782
137 Ga0495634_0001098 3300046642 Bacteria 25127
138 Ga0495659_0041495 3300046664 Unclassified 1644
139 Ga0495599_0152243 3300046678 Bacteria 1432
140 Ga0495669_0008214 3300046684 Bacteria 4382
141 Ga0495674_0034218 3300047319 Bacteria 4596
142 Ga0496108_0197913 3300048911 Bacteria 1743
143 Ga0496109_0482357 3300048912 Bacteria 1170
144 Ga0496111_1292904 3300048914 Unclassified 514
145 Ga0496112_1360026 3300048915 Bacteria 625
146 Ga0496115_0068012 3300048918 Bacteria 2883
147 Ga0501036_0142028 3300049572 Bacteria 2026
148 Ga0501042_0072737 3300049578 Bacteria 2460
149 Ga0501048_1082064 3300049582 Bacteria 577
150 nmdc:mga05p37_544684_c1 3300050507 Unclassified 1322
151 nmdc:mga05p37_678459_c1 3300050507 Bacteria 1149
152 nmdc:mga09592_1488789_c1 3300050508 Bacteria 551
153 nmdc:mga09592_24312_c1 3300050508 Bacteria 5009
154 nmdc:mga0qj67_218767_c1 3300050509 Bacteria 1546
155 nmdc:mga06r32_126136_c1 3300050510 Bacteria 2528
156 nmdc:mga06r32_186652_c1 3300050510 Bacteria 2060
157 nmdc:mga06r32_509329_c1 3300050510 Bacteria 1180
158 nmdc:mga0n895_134683_c1 3300050512 Bacteria 2497
159 nmdc:mga0n895_480253_c1 3300050512 Bacteria 1253
160 nmdc:mga0n895_893379_c1 3300050512 Bacteria 874
161 nmdc:mga08x19_1037247_c1 3300050514 Bacteria 582
162 nmdc:mga08x19_52578_c1 3300050514 Bacteria 2620
163 nmdc:mga0a205_68251_c1 3300050515 Bacteria 3434
164 Ga0495601_0075349 3300053077 Bacteria 2160
165 2847932381 2847930680 Bacteria 9342022
166 Ga0065704_10049380
167 Ga0065704_10847908
168 Ga0065715_10436954
169 Ga0065707_10287578
170 Ga0065707_10577120
171 Ga0070666_11172447
172 Ga0070680_100569263
173 Ga0070687_100860080
174 Ga0070692_10000091
175 Ga0070669_102039874
176 Ga0070709_10277906
177 Ga0070709_11009649
178 Ga0070714_100772047
179 Ga0070713_101851695
180 Ga0070711_100150415
181 Ga0070711_101279285
182 Ga0070705_100061910
183 Ga0070705_100191634
184 Ga0070694_100000304
185 Ga0070694_100900948
186 Ga0070708_100013946
187 Ga0070708_100125935
188 Ga0070708_100538440
189 Ga0070708_101003019
190 Ga0070708_101916558
191 Ga0070706_100004214
192 Ga0070706_100032822
193 Ga0070706_100200056
194 Ga0070706_100309354
195 Ga0070706_100993635
196 Ga0070706_101466099
197 Ga0070707_100037179
198 Ga0070707_100141816
199 Ga0070707_100468435
200 Ga0070707_101530486
201 Ga0070698_100406683
202 Ga0070698_100662916
203 Ga0070698_100766675
204 Ga0070699_100132623
205 Ga0070699_100998121
206 Ga0070699_101624731
207 Ga0070699_102050917
208 Ga0070697_100018146
209 Ga0070697_100031981
210 Ga0070697_100179437
211 Ga0070697_100296162
212 Ga0070697_100888198
213 Ga0070697_101009298
214 Ga0070697_101273453
215 Ga0070695_100341050
216 Ga0070695_100656714
217 Ga0070696_100580497
218 Ga0070696_100597561
219 Ga0070704_100196253
220 Ga0070704_100557522
221 Ga0070704_101333053
222 Ga0070664_100517693
223 Ga0070664_101953679
224 Ga0068854_101358612
225 Ga0068861_101240739
226 Ga0068863_100970589
227 Ga0068862_100974040
228 Ga0081455_10023538
229 Ga0081455_10057061
230 Ga0070716_100112600
231 Ga0070712_100030729
232 Ga0070712_100655644
233 Ga0070712_101410935
234 Ga0097621_100039000
235 Ga0068871_100018711
236 Ga0068871_100241938
237 Ga0075428_101086329
238 Ga0075430_100230958
239 Ga0075430_100524924
240 Ga0075431_100011801
241 Ga0075431_100031627
242 Ga0075431_100264405
243 Ga0075431_100756964
244 Ga0075433_10259930
245 Ga0075433_10490607
246 Ga0075434_100375959
247 Ga0075434_100556174
248 Ga0075429_100005528
249 Ga0075429_101726688
250 Ga0075436_100021696
251 Ga0075436_100320953
252 Ga0075435_100801658
253 Ga0099794_10714844
254 Ga0111539_10464889
255 Ga0111539_13355059
256 Ga0114129_10012722
257 Ga0114129_10794336
258 Ga0114129_10845693
259 Ga0114129_12465168
260 Ga0114129_12767334
261 Ga0105237_12214239
262 Ga0157378_10010422
263 Ga0157378_11311158
264 Ga0163163_11994849
265 Ga0157376_10028543
266 Ga0157376_10065184
267 Ga0207680_11067571
268 Ga0207684_10000740
269 Ga0207684_10081777
270 Ga0207684_10734194
271 Ga0207684_10864211
272 Ga0207693_10047291
273 Ga0207693_10094136
274 Ga0207663_10022897
275 Ga0207660_10238568
276 Ga0207646_10008309
277 Ga0207646_10332920
278 Ga0207681_11409280
279 Ga0207659_11768656
280 Ga0207700_11563091
281 Ga0207664_10307186
282 Ga0207665_10295661
283 Ga0207665_10839106
284 Ga0207679_10844603
285 Ga0209974_10074016
286 Ga0265338_10001531
287 Ga0265324_10007892
288 Ga0265331_10249173
289 Ga0373949_0016269
290 Ga0373932_0127813
291 Ga0373931_0236448
292 Ga0373935_1289031
293 Ga0373925_0370141
294 Ga0451791_1285251
295 Ga0451576_0246844
296 Ga0495590_0428339
297 Ga0495580_0128841
298 Ga0495639_0053603
299 Ga0495664_0040444
300 Ga0495630_0027358
301 Ga0495586_0011121
302 Ga0495634_0001098
303 Ga0495659_0041495
304 Ga0495599_0152243
305 Ga0495669_0008214
306 Ga0495674_0034218
307 Ga0496108_0197913
308 Ga0496109_0482357
309 Ga0496111_1292904
310 Ga0496112_1360026
311 Ga0496115_0068012
312 Ga0501036_0142028
313 Ga0501042_0072737
314 Ga0501048_1082064
315 nmdc:mga05p37_544684_c1
316 nmdc:mga05p37_678459_c1
317 nmdc:mga09592_1488789_c1
318 nmdc:mga09592_24312_c1
319 nmdc:mga0qj67_218767_c1
320 nmdc:mga06r32_126136_c1
321 nmdc:mga06r32_186652_c1
322 nmdc:mga06r32_509329_c1
323 nmdc:mga0n895_134683_c1
324 nmdc:mga0n895_480253_c1
325 nmdc:mga0n895_893379_c1
326 nmdc:mga08x19_1037247_c1
327 nmdc:mga08x19_52578_c1
328 nmdc:mga0a205_68251_c1
329 Ga0495601_0075349
330 2847932381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11746

DUF3303

Domain of unknown function (DUF3303)

1

102

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.7009 1 78
4pcq-assembly1.cif.gz_B crystal structure of mtbaldr (rv2779c) 0.6926 2 79
4pcq-assembly2.cif.gz_D crystal structure of mtbaldr (rv2779c) 0.6816 2 79
4pcq-assembly2.cif.gz_C crystal structure of mtbaldr (rv2779c) 0.6746 2 79
2cfx-assembly1.cif.gz_C structure of b.subtilis lrpc 0.6567 2 79
ID Description Score Start End Superfamily
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7154 3 76 3.30.70.3090
af_Q4DKY3_4_112_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6902 2 79 3.30.70.100
af_B7ZZ41_1_67_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6828 4 68 3.30.70.100
4pcqD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6797 2 76 3.30.70.920
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.6754 32 54 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A4U1ALG3-F1-model_v4 DUF3303 domain-containing protein 1.001 2 77
AF-A0A2T1CH88-F1-model_v4 DUF3303 domain-containing protein 0.9965 1 90
AF-A0A7Y5BXQ3-F1-model_v4 DUF3303 family protein 0.9957 1 79
AF-A0A1Z4SZR0-F1-model_v4 deleted 0.9849 1 90
AF-A0A1Q4RXJ0-F1-model_v4 deleted 0.9804 1 90

Map