F247102

General Info

Members Datasets Scaffolds Average Seq Length
165 95 163 252

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0000405|Ga0501038_0000405_31222_32058
Length 278
Sequence MQRMDTPETSEISSSSPATEPSIAGREEIVRTIDVVKEYKLAAAAKEDGGASGAGDNGVSRVLKGINLTIYKGEYISIMGPSGSGKSTLFNAIGGLDKPTSGKVFIDEVDVAQLDALELAWLRCRKIGYIFQTFNLIPVMTALENVALPMIFAGLSTTAAQEKAAGILRRVELGHRLFNRPSQLSGGQQQRVAIARAFANDPAIILADEPTGNLDLNTGKAIIGLLREMNKERGVTIISATHDFKMLDVSDRIIWIRDGQIDKIQRREEVDIRTGEIH

Samples

Sample ID Description Type Environment
1 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
2 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
10 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
15 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
18 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
19 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
20 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
21 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
22 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
23 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
30 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
31 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
32 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
33 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
34 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
35 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
36 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
37 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
38 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
39 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
40 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
41 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
42 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
43 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
44 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
45 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
48 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
49 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
50 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
53 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
54 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
55 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
56 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
57 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
58 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
59 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
62 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
63 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
64 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
65 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
66 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
67 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
68 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
69 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
70 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
71 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
75 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
76 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
77 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
86 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
87 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
90 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
93 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
94 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
95 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 1.21
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.21
Rhizosphere 86.06
Stem 0
Stem Tuber 0
Unclassified 12.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100056604 3300005331 Bacteria 3365
2 Ga0070675_100025887 3300005354 Bacteria 4705
3 Ga0070667_100625597 3300005367 Bacteria 993
4 Ga0070701_10354708 3300005438 Bacteria 917
5 Ga0070678_100532188 3300005456 Bacteria 1041
6 Ga0070665_100001093 3300005548 Bacteria 33580
7 Ga0068859_100674394 3300005617 Bacteria 1125
8 Ga0081539_10019253 3300005985 Bacteria 4682
9 Ga0070717_10021749 3300006028 Bacteria 5059
10 Ga0075428_100066578 3300006844 Bacteria 3944
11 Ga0075431_100142886 3300006847 Bacteria 2467
12 Ga0075429_100025579 3300006880 Bacteria 5124
13 Ga0075429_100045743 3300006880 Bacteria 3808
14 Ga0097620_100674231 3300006931 Bacteria 1125
15 Ga0114129_10016058 3300009147 Bacteria 10651
16 Ga0105248_10161600 3300009177 Bacteria 2526
17 Ga0105249_10588097 3300009553 Bacteria 1167
18 Ga0157372_10109149 3300013307 Bacteria 3168
19 Ga0157379_10129514 3300014968 Bacteria 2271
20 Ga0163161_10111568 3300017792 Bacteria 2045
21 Ga0163161_10309340 3300017792 Bacteria 1246
22 Ga0213875_10000082 3300021388 Bacteria 112075
23 Ga0207705_10001155 3300025909 Bacteria 21465
24 Ga0207650_10060435 3300025925 Bacteria 2828
25 Ga0207659_10039634 3300025926 Bacteria 3288
26 Ga0207711_10104793 3300025941 Bacteria 2507
27 Ga0268266_10009744 3300028379 Bacteria 8449
28 Ga0268265_10236623 3300028380 Bacteria 1609
29 Ga0265318_10026911 3300028577 Bacteria 2263
30 Ga0265318_10029137 3300028577 Bacteria 2154
31 Ga0265322_10048076 3300028654 Bacteria 1212
32 Ga0265338_10002403 3300028800 Bacteria 28165
33 Ga0265332_10031343 3300031238 Bacteria 2319
34 Ga0265325_10060602 3300031241 Bacteria 1922
35 Ga0265329_10055896 3300031242 Bacteria 1252
36 Ga0265339_10015521 3300031249 Bacteria 4562
37 Ga0265316_10002849 3300031344 Bacteria 17699
38 Ga0265316_10049159 3300031344 Bacteria 3323
39 Ga0316575_10000920 3300031665 Bacteria 9051
40 Ga0316575_10011326 3300031665 Bacteria 3298
41 Ga0316575_10066775 3300031665 Bacteria 1441
42 Ga0316575_10069096 3300031665 Bacteria 1417
43 Ga0316575_10084211 3300031665 Bacteria 1284
44 Ga0316579_10006711 3300031691 Bacteria 4712
45 Ga0316579_10007907 3300031691 Bacteria 4410
46 Ga0316579_10047236 3300031691 Bacteria 2010
47 Ga0265314_10001872 3300031711 Bacteria 22556
48 Ga0265314_10002264 3300031711 Bacteria 19926
49 Ga0265342_10123141 3300031712 Bacteria 1458
50 Ga0316576_10002851 3300031727 Bacteria 9964
51 Ga0316576_10017347 3300031727 Bacteria 4888
52 Ga0316576_10020835 3300031727 Bacteria 4523
53 Ga0316576_10067697 3300031727 Bacteria 2629
54 Ga0316578_10003975 3300031728 Bacteria 6891
55 Ga0316578_10011521 3300031728 Bacteria 4632
56 Ga0316578_10020302 3300031728 Bacteria 3669
57 Ga0316578_10022584 3300031728 Bacteria 3509
58 Ga0316578_10045663 3300031728 Bacteria 2551
59 Ga0316578_10061727 3300031728 Bacteria 2209
60 Ga0316578_10070195 3300031728 Bacteria 2073
61 Ga0316578_10140420 3300031728 Bacteria 1455
62 Ga0307405_10319287 3300031731 Bacteria 1186
63 Ga0316577_10000985 3300031733 Bacteria 12720
64 Ga0316577_10015161 3300031733 Bacteria 4239
65 Ga0316577_10044190 3300031733 Bacteria 2492
66 Ga0307412_10206131 3300031911 Bacteria 1497
67 Ga0307409_100062826 3300031995 Bacteria 2909
68 Ga0307409_100296869 3300031995 Bacteria 1501
69 Ga0316583_10043955 3300032133 Bacteria 1579
70 Ga0316583_10075854 3300032133 Bacteria 1175
71 Ga0316585_10000593 3300032137 Bacteria 8854
72 Ga0316585_10000602 3300032137 Bacteria 8803
73 Ga0316585_10026574 3300032137 Bacteria 1801
74 Ga0316585_10031160 3300032137 Bacteria 1676
75 Ga0316580_10002971 3300032139 Bacteria 4760
76 Ga0316580_10088982 3300032139 Bacteria 945
77 Ga0316586_1005760 3300033527 Bacteria 1755
78 Ga0316588_1011217 3300033528 Bacteria 1906
79 Ga0373941_0086124 3300035115 Bacteria 1070
80 Ga0373960_0152069 3300035121 Bacteria 791
81 Ga0373961_0027557 3300035241 Bacteria 1561
82 Ga0316574_0000843 3300035398 Bacteria 13423
83 Ga0316574_0003094 3300035398 Bacteria 8495
84 Ga0316574_0016442 3300035398 Bacteria 4312
85 Ga0316574_0025066 3300035398 Bacteria 3577
86 Ga0316574_0465690 3300035398 Bacteria 791
87 Ga0373931_0223051 3300035691 Bacteria 1136
88 Ga0373927_0000853 3300035695 Bacteria 23252
89 Ga0373927_0001411 3300035695 Bacteria 18121
90 Ga0316582_0003108 3300036647 Bacteria 8037
91 Ga0316582_0008998 3300036647 Bacteria 5396
92 Ga0316582_0038177 3300036647 Bacteria 2983
93 Ga0316582_0042879 3300036647 Bacteria 2836
94 Ga0316582_0056365 3300036647 Bacteria 2507
95 Ga0316582_0068525 3300036647 Bacteria 2291
96 Ga0316582_0072346 3300036647 Bacteria 2235
97 Ga0316582_0083687 3300036647 Bacteria 2088
98 Ga0316582_0173859 3300036647 Bacteria 1463
99 Ga0316582_0178576 3300036647 Bacteria 1444
100 Ga0316584_0000536 3300036712 Bacteria 20312
101 Ga0316584_0005960 3300036712 Bacteria 8229
102 Ga0316584_0017281 3300036712 Bacteria 5182
103 Ga0316584_0022044 3300036712 Bacteria 4641
104 Ga0316584_0027798 3300036712 Bacteria 4165
105 Ga0316584_0045023 3300036712 Bacteria 3292
106 Ga0316584_0054730 3300036712 Bacteria 2987
107 Ga0316584_0076540 3300036712 Bacteria 2507
108 Ga0316584_0093241 3300036712 Bacteria 2255
109 Ga0316584_0097152 3300036712 Bacteria 2205
110 Ga0316584_0178057 3300036712 Bacteria 1575
111 Ga0316584_0288042 3300036712 Bacteria 1192
112 Ga0316584_0297724 3300036712 Bacteria 1169
113 Ga0373925_0001144 3300037068 Bacteria 23549
114 Ga0373925_0001509 3300037068 Bacteria 19927
115 Ga0316581_0056765 3300037588 Bacteria 1200
116 Ga0436364_0900039 3300037853 Bacteria 109765
117 Ga0400484_27577 3300038725 Bacteria 6423
118 Ga0400490_42180 3300038726 Bacteria 9503
119 Ga0400491_03110 3300038727 Bacteria 2153
120 Ga0400485_11374 3300038735 Bacteria 75370
121 Ga0400488_28743 3300038741 Bacteria 2119
122 Ga0400488_31963 3300038741 Bacteria 2415
123 Ga0400488_33639 3300038741 Bacteria 2055
124 Ga0400486_10961 3300038742 Bacteria 98465
125 Ga0400483_002047 3300039062 Bacteria 2040
126 Ga0400483_087665 3300039062 Bacteria 5205
127 Ga0400483_165697 3300039062 Bacteria 3106
128 Ga0400483_183848 3300039062 Bacteria 1326
129 Ga0400483_189338 3300039062 Bacteria 7444
130 Ga0400489_39280 3300039093 Bacteria 7120
131 Ga0400489_67104 3300039093 Bacteria 22090
132 Ga0400489_91832 3300039093 Bacteria 2729
133 Ga0400489_93013 3300039093 Bacteria 1068
134 Ga0400487_57720 3300039110 Bacteria 20772
135 Ga0451577_0254407 3300042876 Bacteria 1590
136 Ga0453684_0007229 3300044712 Bacteria 20587
137 Ga0453684_0223629 3300044712 Bacteria 2179
138 Ga0495630_0652280 3300046517 Bacteria 806
139 Ga0495684_0057161 3300047471 Bacteria 2974
140 Ga0495614_0147045 3300048089 Bacteria 1050
141 Ga0496100_0565533 3300048903 Bacteria 881
142 Ga0501034_0000565 3300049571 Bacteria 58696
143 Ga0501034_0000594 3300049571 Bacteria 57193
144 Ga0501036_0054755 3300049572 Bacteria 3380
145 Ga0501038_0000405 3300049574 Bacteria 37444
146 Ga0501043_0004503 3300049579 Bacteria 11323
147 Ga0501043_0201923 3300049579 Bacteria 1543
148 Ga0501043_0313490 3300049579 Bacteria 1197
149 Ga0501046_0000044 3300049580 Bacteria 151271
150 Ga0501047_0175460 3300049581 Bacteria 2010
151 Ga0501048_0004312 3300049582 Bacteria 10841
152 Ga0501075_0277528 3300049591 Bacteria 1277
153 Ga0501252_030413 3300049682 Bacteria 746
154 Ga0501079_0200470 3300049741 Bacteria 1559
155 Ga0501080_0676259 3300049742 Bacteria 912
156 Ga0501083_0000008 3300049744 Bacteria 197749
157 Ga0501035_0043631 3300049822 Bacteria 4040
158 Ga0501035_0296754 3300049822 Bacteria 1363
159 Ga0501044_0017228 3300049823 Bacteria 7749
160 nmdc:mga05p37_9670_c1 3300050507 Bacteria 11428
161 nmdc:mga09592_42203_c1 3300050508 Bacteria 3837
162 Ga0501084_0200422 3300054114 Bacteria 1684
163 Ga0501082_0383207 3300060353 Bacteria 1227

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031728 Ga0316578_10045663 Ga0316578_100456632 227
2 3300036647 Ga0316582_0072346 Ga0316582_0072346_1205_1942 227
3 3300049682 Ga0501252_030413 Ga0501252_030413_52_735 227
4 3300046517 Ga0495630_0652280 Ga0495630_0652280_100_795 231
5 3300036712 Ga0316584_0288042 Ga0316584_0288042_214_921 235
6 3300028577 Ga0265318_10026911 Ga0265318_100269112 239
7 3300028654 Ga0265322_10048076 Ga0265322_100480761 239
8 3300028800 Ga0265338_10002403 Ga0265338_1000240311 239
9 3300031241 Ga0265325_10060602 Ga0265325_100606022 239
10 3300031242 Ga0265329_10055896 Ga0265329_100558962 239
11 3300031344 Ga0265316_10002849 Ga0265316_100028496 239
12 3300031344 Ga0265316_10049159 Ga0265316_100491592 239
13 3300031712 Ga0265342_10123141 Ga0265342_101231412 239
14 3300031727 Ga0316576_10067697 Ga0316576_100676972 241
15 3300031728 Ga0316578_10061727 Ga0316578_100617272 241
16 3300031731 Ga0307405_10319287 Ga0307405_103192872 241
17 3300035398 Ga0316574_0003094 Ga0316574_0003094_5266_5991 241
18 3300035398 Ga0316574_0465690 Ga0316574_0465690_20_745 241
19 3300036647 Ga0316582_0178576 Ga0316582_0178576_691_1416 241
20 3300036712 Ga0316584_0093241 Ga0316584_0093241_711_1436 241
21 3300049591 Ga0501075_0277528 Ga0501075_0277528_213_959 241
22 3300049741 Ga0501079_0200470 Ga0501079_0200470_636_1382 241
23 3300049742 Ga0501080_0676259 Ga0501080_0676259_135_881 241
24 3300060353 Ga0501082_0383207 Ga0501082_0383207_418_1164 241
25 iso_pu_bacteria 2740891818 2740991344 241
26 3300009177 Ga0105248_10161600 Ga0105248_101616002 243
27 3300025941 Ga0207711_10104793 Ga0207711_101047932 243
28 3300005367 Ga0070667_100625597 Ga0070667_1006255971 244
29 3300005548 Ga0070665_100001093 Ga0070665_10000109327 244
30 3300028379 Ga0268266_10009744 Ga0268266_100097447 244
31 3300028380 Ga0268265_10236623 Ga0268265_102366232 244
32 3300028577 Ga0265318_10029137 Ga0265318_100291372 244
33 3300044712 Ga0453684_0007229 Ga0453684_0007229_15122_15856 244
34 3300005456 Ga0070678_100532188 Ga0070678_1005321882 245
35 3300006880 Ga0075429_100045743 Ga0075429_1000457433 245
36 3300031665 Ga0316575_10011326 Ga0316575_100113262 245
37 3300031665 Ga0316575_10066775 Ga0316575_100667752 245
38 3300031691 Ga0316579_10047236 Ga0316579_100472362 245
39 3300031728 Ga0316578_10011521 Ga0316578_100115213 245
40 3300031728 Ga0316578_10070195 Ga0316578_100701952 245
41 3300031733 Ga0316577_10000985 Ga0316577_100009856 245
42 3300031733 Ga0316577_10044190 Ga0316577_100441902 245
43 3300031911 Ga0307412_10206131 Ga0307412_102061312 245
44 3300032133 Ga0316583_10043955 Ga0316583_100439551 245
45 3300032133 Ga0316583_10075854 Ga0316583_100758542 245
46 3300032139 Ga0316580_10088982 Ga0316580_100889821 245
47 3300035115 Ga0373941_0086124 Ga0373941_0086124_95_832 245
48 3300035121 Ga0373960_0152069 Ga0373960_0152069_14_751 245
49 3300035398 Ga0316574_0016442 Ga0316574_0016442_191_928 245
50 3300035691 Ga0373931_0223051 Ga0373931_0223051_291_1028 245
51 3300035695 Ga0373927_0000853 Ga0373927_0000853_3351_4088 245
52 3300036647 Ga0316582_0038177 Ga0316582_0038177_384_1121 245
53 3300036647 Ga0316582_0042879 Ga0316582_0042879_798_1535 245
54 3300036647 Ga0316582_0056365 Ga0316582_0056365_182_919 245
55 3300036647 Ga0316582_0068525 Ga0316582_0068525_1070_1807 245
56 3300036647 Ga0316582_0083687 Ga0316582_0083687_918_1655 245
57 3300036712 Ga0316584_0017281 Ga0316584_0017281_3395_4132 245
58 3300036712 Ga0316584_0022044 Ga0316584_0022044_3423_4160 245
59 3300036712 Ga0316584_0027798 Ga0316584_0027798_307_1044 245
60 3300036712 Ga0316584_0054730 Ga0316584_0054730_1131_1868 245
61 3300036712 Ga0316584_0097152 Ga0316584_0097152_1040_1777 245
62 3300036712 Ga0316584_0297724 Ga0316584_0297724_400_1137 245
63 3300037068 Ga0373925_0001509 Ga0373925_0001509_8392_9129 245
64 3300037588 Ga0316581_0056765 Ga0316581_0056765_369_1106 245
65 3300038725 Ga0400484_27577 Ga0400484_27577_3717_4454 245
66 3300038726 Ga0400490_42180 Ga0400490_42180_501_1238 245
67 3300038741 Ga0400488_31963 Ga0400488_31963_135_872 245
68 3300038741 Ga0400488_33639 Ga0400488_33639_819_1556 245
69 3300039062 Ga0400483_087665 Ga0400483_087665_918_1655 245
70 3300039062 Ga0400483_189338 Ga0400483_189338_2190_2927 245
71 3300039093 Ga0400489_39280 Ga0400489_39280_5869_6606 245
72 3300039093 Ga0400489_93013 Ga0400489_93013_117_854 245
73 3300049579 Ga0501043_0313490 Ga0501043_0313490_240_1067 245
74 3300017792 Ga0163161_10111568 Ga0163161_101115682 246
75 3300031665 Ga0316575_10000920 Ga0316575_100009204 246
76 3300031665 Ga0316575_10069096 Ga0316575_100690962 246
77 3300031691 Ga0316579_10006711 Ga0316579_100067112 246
78 3300031691 Ga0316579_10007907 Ga0316579_100079074 246
79 3300031711 Ga0265314_10001872 Ga0265314_1000187219 246
80 3300031727 Ga0316576_10017347 Ga0316576_100173472 246
81 3300031728 Ga0316578_10003975 Ga0316578_100039752 246
82 3300031728 Ga0316578_10022584 Ga0316578_100225842 246
83 3300031733 Ga0316577_10015161 Ga0316577_100151617 246
84 3300032137 Ga0316585_10000593 Ga0316585_100005933 246
85 3300032137 Ga0316585_10000602 Ga0316585_100006023 246
86 3300032137 Ga0316585_10026574 Ga0316585_100265742 246
87 3300032139 Ga0316580_10002971 Ga0316580_100029712 246
88 3300033527 Ga0316586_1005760 Ga0316586_10057603 246
89 3300033528 Ga0316588_1011217 Ga0316588_10112172 246
90 3300035398 Ga0316574_0000843 Ga0316574_0000843_10926_11666 246
91 3300036647 Ga0316582_0003108 Ga0316582_0003108_1630_2370 246
92 3300036647 Ga0316582_0008998 Ga0316582_0008998_2456_3196 246
93 3300036712 Ga0316584_0005960 Ga0316584_0005960_3804_4544 246
94 3300036712 Ga0316584_0045023 Ga0316584_0045023_1348_2088 246
95 3300036712 Ga0316584_0076540 Ga0316584_0076540_758_1498 246
96 3300038727 Ga0400491_03110 Ga0400491_03110_598_1338 246
97 3300038735 Ga0400485_11374 Ga0400485_11374_55146_55886 246
98 3300038741 Ga0400488_28743 Ga0400488_28743_183_923 246
99 3300038742 Ga0400486_10961 Ga0400486_10961_20303_21043 246
100 3300039062 Ga0400483_002047 Ga0400483_002047_808_1548 246
101 3300039062 Ga0400483_183848 Ga0400483_183848_391_1131 246
102 3300039093 Ga0400489_67104 Ga0400489_67104_19113_19853 246
103 3300039110 Ga0400487_57720 Ga0400487_57720_993_1733 246
104 3300014968 Ga0157379_10129514 Ga0157379_101295144 247
105 3300031728 Ga0316578_10020302 Ga0316578_100203022 247
106 3300036647 Ga0316582_0173859 Ga0316582_0173859_689_1432 247
107 3300036712 Ga0316584_0178057 Ga0316584_0178057_661_1404 247
108 3300048903 Ga0496100_0565533 Ga0496100_0565533_55_798 247
109 3300049822 Ga0501035_0296754 Ga0501035_0296754_339_1160 248
110 3300009147 Ga0114129_10016058 Ga0114129_100160582 249
111 3300031665 Ga0316575_10084211 Ga0316575_100842112 249
112 3300050507 nmdc:mga05p37_9670_c1 nmdc:mga05p37_9670_c1_1301_2155 249
113 3300050508 nmdc:mga09592_42203_c1 nmdc:mga09592_42203_c1_2354_3208 249
114 3300049571 Ga0501034_0000594 Ga0501034_0000594_10396_11193 252
115 3300049823 Ga0501044_0017228 Ga0501044_0017228_3167_3943 252
116 3300049571 Ga0501034_0000565 Ga0501034_0000565_33379_34200 253
117 3300049572 Ga0501036_0054755 Ga0501036_0054755_2033_2860 253
118 3300049574 Ga0501038_0000405 Ga0501038_0000405_31222_32058 253
119 3300049579 Ga0501043_0004503 Ga0501043_0004503_8306_9085 253
120 3300049579 Ga0501043_0201923 Ga0501043_0201923_311_1132 253
121 3300049580 Ga0501046_0000044 Ga0501046_0000044_114972_115751 253
122 3300049581 Ga0501047_0175460 Ga0501047_0175460_889_1668 253
123 3300049582 Ga0501048_0004312 Ga0501048_0004312_7152_7931 253
124 3300049744 Ga0501083_0000008 Ga0501083_0000008_114720_115499 253
125 3300049822 Ga0501035_0043631 Ga0501035_0043631_599_1378 253
126 3300054114 Ga0501084_0200422 Ga0501084_0200422_821_1600 253
127 iso_pu_bacteria 2786546517 2787433988 253
128 3300005617 Ga0068859_100674394 Ga0068859_1006743942 254
129 3300006931 Ga0097620_100674231 Ga0097620_1006742312 254
130 3300039062 Ga0400483_165697 Ga0400483_165697_922_1716 254
131 3300042876 Ga0451577_0254407 Ga0451577_0254407_50_820 255
132 3300031727 Ga0316576_10020835 Ga0316576_100208352 256
133 3300031728 Ga0316578_10140420 Ga0316578_101404202 256
134 3300039093 Ga0400489_91832 Ga0400489_91832_1361_2209 256
135 3300044712 Ga0453684_0223629 Ga0453684_0223629_1182_1967 256
136 3300005438 Ga0070701_10354708 Ga0070701_103547082 257
137 3300021388 Ga0213875_10000082 Ga0213875_1000008261 257
138 3300037853 Ga0436364_0900039 Ga0436364_0900039_26481_27347 257
139 3300031238 Ga0265332_10031343 Ga0265332_100313432 258
140 3300031249 Ga0265339_10015521 Ga0265339_100155215 258
141 3300031711 Ga0265314_10002264 Ga0265314_100022648 258
142 3300031727 Ga0316576_10002851 Ga0316576_100028512 258
143 3300032137 Ga0316585_10031160 Ga0316585_100311601 258
144 3300035398 Ga0316574_0025066 Ga0316574_0025066_1955_2749 258
145 3300036712 Ga0316584_0000536 Ga0316584_0000536_3699_4493 258
146 3300006844 Ga0075428_100066578 Ga0075428_1000665782 260
147 3300006847 Ga0075431_100142886 Ga0075431_1001428862 260
148 3300006880 Ga0075429_100025579 Ga0075429_1000255797 260
149 3300005331 Ga0070670_100056604 Ga0070670_1000566043 261
150 3300005354 Ga0070675_100025887 Ga0070675_1000258876 261
151 3300005985 Ga0081539_10019253 Ga0081539_100192532 261
152 3300006028 Ga0070717_10021749 Ga0070717_100217494 261
153 3300009553 Ga0105249_10588097 Ga0105249_105880971 261
154 3300013307 Ga0157372_10109149 Ga0157372_101091492 261
155 3300017792 Ga0163161_10309340 Ga0163161_103093402 261
156 3300025909 Ga0207705_10001155 Ga0207705_100011556 261
157 3300025925 Ga0207650_10060435 Ga0207650_100604353 261
158 3300025926 Ga0207659_10039634 Ga0207659_100396342 261
159 3300031995 Ga0307409_100062826 Ga0307409_1000628262 261
160 3300031995 Ga0307409_100296869 Ga0307409_1002968692 261
161 3300035241 Ga0373961_0027557 Ga0373961_0027557_170_1003 261
162 3300035695 Ga0373927_0001411 Ga0373927_0001411_7848_8681 261
163 3300037068 Ga0373925_0001144 Ga0373925_0001144_6403_7236 261
164 3300047471 Ga0495684_0057161 Ga0495684_0057161_697_1482 261
165 3300048089 Ga0495614_0147045 Ga0495614_0147045_135_920 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

63

212

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9772 17 242
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9749 17 239
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9726 17 239
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9725 18 241
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9643 17 242
ID Description Score Start End Superfamily
af_Q8T664_36_360_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9803 17 241 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9796 45 241 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9795 16 240 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9793 14 236 3.40.50.300
af_P9WQK1_1_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9782 14 236 3.40.50.300
ID Description Score Start End GO Terms
AF-H8FG51-F1-model_v4 deleted 0.9874 17 218
AF-X1I1Q5-F1-model_v4 ABC transporter domain-containing protein 0.9818 69 204 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0044874
GO:0089705
AF-A0A377TL40-F1-model_v4 Methionine ABC transporter ATP-binding protein (EC 3.6.3.-) 0.9811 69 208 GO:0005524
GO:0005886
GO:0016887
AF-A0A1F8CYG4-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.98 54 240 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A0J6SXG5-F1-model_v4 Methionine ABC transporter ATP-binding protein 0.9799 54 241 GO:0005524
GO:0006865
GO:0016887

Feature Viewer

pLDDT pTM Quality
86.95 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map