F246985

General Info

Members Datasets Scaffolds Average Seq Length
165 110 330 283

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0011464|Ga0496100_0011464_1212_2156
Length 314
Sequence MRHGVLPLFDGPVRFSHVDAPVSPVKVRNSALKLASFSVHGRVSYGALVGDGIVDLGPRLKHASVLDLLRVGALDEARNAADAKPDMALKDVTLLRPVVFPEKILCIGVNYGNRHAEYKDGSEQAKYPSMFFRTPGSFVGSGEPLVKPAVTQQFDYEGEIALVIGREGRRIPKERAYEHIAGYTLCNEGTAREWTRHSKFNVTQGKNFDGSGSLGPWMVTADAVDPAKPLHLTTKVNGELRQDDTTANLLFTFADLLAYITIFTTLKPGDIIVTGTPVGAGARFDPPRWLKAGDVVEVAVPEIGTLSNRVVEEG

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
71 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
99 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
108 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
109 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
110 2508501125 Burkholderia sp. WSM2232 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.94
Nodule 0.61
Rhizoplane 0.61
Rhizosphere 84.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0011464 3300048903 Bacteria 5047
2 Ga0065165_1000048 3300005262 Bacteria 196539
3 Ga0070658_10022012 3300005327 Bacteria 5113
4 Ga0070690_100158580 3300005330 Bacteria 1549
5 Ga0070680_100003611 3300005336 Bacteria 11551
6 Ga0070660_100022763 3300005339 Bacteria 4640
7 Ga0070660_100095555 3300005339 Bacteria 2349
8 Ga0070660_100208398 3300005339 Bacteria 1586
9 Ga0070660_100368396 3300005339 Bacteria 1185
10 Ga0070691_10132875 3300005341 Bacteria 1262
11 Ga0070687_100189361 3300005343 Bacteria 1239
12 Ga0070692_10022231 3300005345 Bacteria 3096
13 Ga0070692_10076984 3300005345 Bacteria 1789
14 Ga0070668_100157056 3300005347 Bacteria 1843
15 Ga0070673_100389399 3300005364 Bacteria 1244
16 Ga0070659_100013809 3300005366 Bacteria 6024
17 Ga0070714_100704345 3300005435 Bacteria 974
18 Ga0070708_100368271 3300005445 Bacteria 1354
19 Ga0070662_100001520 3300005457 Bacteria 14270
20 Ga0070662_100053415 3300005457 Bacteria 2924
21 Ga0070706_100048614 3300005467 Bacteria 3914
22 Ga0070707_100253663 3300005468 Bacteria 1712
23 Ga0070679_100016046 3300005530 Bacteria 7214
24 Ga0070697_100073894 3300005536 Bacteria 2800
25 Ga0070695_100214110 3300005545 Bacteria 1385
26 Ga0070704_100001202 3300005549 Bacteria 13572
27 Ga0070704_100137763 3300005549 Bacteria 1901
28 Ga0068855_100165997 3300005563 Bacteria 2503
29 Ga0068855_100615754 3300005563 Bacteria 1169
30 Ga0070664_100023937 3300005564 Bacteria 5046
31 Ga0068852_100008722 3300005616 Bacteria 7495
32 Ga0068859_100359109 3300005617 Bacteria 1552
33 Ga0068861_100005813 3300005719 Bacteria 8372
34 Ga0068861_100097824 3300005719 Bacteria 2328
35 Ga0068860_100216913 3300005843 Bacteria 1857
36 Ga0075365_10001473 3300006038 Bacteria 10700
37 Ga0075365_10268723 3300006038 Bacteria 1199
38 Ga0075368_10015158 3300006042 Bacteria 2855
39 Ga0075363_100047059 3300006048 Bacteria 2290
40 Ga0075363_100070816 3300006048 Bacteria 1894
41 Ga0075364_10002806 3300006051 Bacteria 9801
42 Ga0075364_10014270 3300006051 Bacteria 4906
43 Ga0075367_10056454 3300006178 Bacteria 2333
44 Ga0075369_10038948 3300006186 Bacteria 2029
45 Ga0075428_100013544 3300006844 Bacteria 9079
46 Ga0075430_100043664 3300006846 Bacteria 3790
47 Ga0075431_100007748 3300006847 Bacteria 10696
48 Ga0097620_100359114 3300006931 Bacteria 1552
49 Ga0105240_10387240 3300009093 Bacteria 1577
50 Ga0111539_10017271 3300009094 Bacteria 8929
51 Ga0111539_10114919 3300009094 Bacteria 3157
52 Ga0105245_10176740 3300009098 Bacteria 2037
53 Ga0114129_10074906 3300009147 Bacteria 4713
54 Ga0157373_10004777 3300013100 Bacteria 10197
55 Ga0157371_10062523 3300013102 Bacteria 2639
56 Ga0157371_10087682 3300013102 Bacteria 2204
57 Ga0157370_10046939 3300013104 Bacteria 4141
58 Ga0157370_10279612 3300013104 Bacteria 1542
59 Ga0157372_10133830 3300013307 Bacteria 2854
60 Ga0157380_10001065 3300014326 Bacteria 17591
61 Ga0157380_10052170 3300014326 Bacteria 3237
62 Ga0157380_10195187 3300014326 Bacteria 1791
63 Ga0209130_1000071 3300025284 Bacteria 178273
64 Ga0209025_1002646 3300025294 Bacteria 18319
65 Ga0207647_10011163 3300025904 Bacteria 6310
66 Ga0207705_10056947 3300025909 Bacteria 2820
67 Ga0207684_10097259 3300025910 Bacteria 2513
68 Ga0207660_10001359 3300025917 Bacteria 16412
69 Ga0207660_10172223 3300025917 Bacteria 1676
70 Ga0207657_10000092 3300025919 Bacteria 85665
71 Ga0207657_10000834 3300025919 Bacteria 32541
72 Ga0207657_10011546 3300025919 Bacteria 8768
73 Ga0207652_10016689 3300025921 Bacteria 6001
74 Ga0207646_10022451 3300025922 Bacteria 5813
75 Ga0207664_10177288 3300025929 Bacteria 1828
76 Ga0207706_10001268 3300025933 Bacteria 25476
77 Ga0207706_10013337 3300025933 Bacteria 7475
78 Ga0207691_10366010 3300025940 Bacteria 1232
79 Ga0207711_10211686 3300025941 Bacteria 1771
80 Ga0207679_10060173 3300025945 Bacteria 2821
81 Ga0207679_10186499 3300025945 Bacteria 1720
82 Ga0207640_10054409 3300025981 Bacteria 2616
83 Ga0207640_10297152 3300025981 Bacteria 1276
84 Ga0207708_10025037 3300026075 Bacteria 4514
85 Ga0207648_10061579 3300026089 Bacteria 3272
86 Ga0207674_10169767 3300026116 Bacteria 2135
87 Ga0207674_10261614 3300026116 Bacteria 1677
88 Ga0207675_100004368 3300026118 Bacteria 13661
89 Ga0207675_100005583 3300026118 Bacteria 12041
90 Ga0207675_100229550 3300026118 Bacteria 1790
91 Ga0207698_10020796 3300026142 Bacteria 4525
92 Ga0207698_10238101 3300026142 Bacteria 1657
93 Ga0207698_10471940 3300026142 Bacteria 1215
94 Ga0209813_10077669 3300027866 Bacteria 1092
95 Ga0268265_10426827 3300028380 Bacteria 1232
96 Ga0268264_10058207 3300028381 Bacteria 3236
97 Ga0268264_10270470 3300028381 Bacteria 1587
98 Ga0265318_10009681 3300028577 Bacteria 4228
99 Ga0265332_10000508 3300031238 Bacteria 26654
100 Ga0265325_10059268 3300031241 Bacteria 1947
101 Ga0265340_10001840 3300031247 Bacteria 12121
102 Ga0265339_10054700 3300031249 Bacteria 2167
103 Ga0265331_10054534 3300031250 Bacteria 1903
104 Ga0307408_100153782 3300031548 Bacteria 1819
105 Ga0307408_100285239 3300031548 Bacteria 1377
106 Ga0265313_10026585 3300031595 Bacteria 3045
107 Ga0265314_10147127 3300031711 Bacteria 1450
108 Ga0265314_10204015 3300031711 Bacteria 1166
109 Ga0265342_10000573 3300031712 Bacteria 38852
110 Ga0265342_10025400 3300031712 Bacteria 3724
111 Ga0265342_10048083 3300031712 Bacteria 2558
112 Ga0307410_10211261 3300031852 Bacteria 1487
113 Ga0373931_0149245 3300035691 Bacteria 1361
114 Ga0395899_0000132 3300037312 Bacteria 115455
115 Ga0395899_0001034 3300037312 Bacteria 25336
116 Ga0395899_0407363 3300037312 Bacteria 898
117 Ga0395900_0001575 3300037418 Bacteria 27020
118 Ga0395900_0009719 3300037418 Bacteria 9852
119 Ga0395900_0017948 3300037418 Bacteria 7223
120 Ga0395900_0265052 3300037418 Bacteria 1714
121 Ga0395898_0001192 3300037466 Bacteria 39339
122 Ga0395898_0004405 3300037466 Bacteria 15403
123 Ga0395898_0150083 3300037466 Bacteria 2230
124 Ga0395905_0004350 3300037471 Bacteria 14751
125 Ga0395905_0004978 3300037471 Bacteria 13687
126 Ga0395905_0125481 3300037471 Bacteria 2413
127 Ga0395901_0000208 3300038443 Bacteria 73874
128 Ga0395901_0038269 3300038443 Bacteria 4961
129 Ga0395901_0077831 3300038443 Bacteria 3461
130 Ga0395901_0082638 3300038443 Bacteria 3356
131 Ga0395901_0298382 3300038443 Bacteria 1671
132 Ga0436365_1934512 3300039437 Bacteria 1393
133 Ga0436361_0545741 3300039447 Bacteria 4989
134 Ga0439432_001924 3300042006 Bacteria 7841
135 Ga0466958_0304919 3300045836 Bacteria 1023
136 Ga0466967_0006189 3300045976 Bacteria 8435
137 Ga0466967_0084489 3300045976 Bacteria 2872
138 Ga0466967_0200033 3300045976 Bacteria 1892
139 Ga0495582_0023983 3300046473 Bacteria 3336
140 Ga0495615_0049335 3300048090 Bacteria 1079
141 Ga0501040_0062096 3300049576 Bacteria 2571
142 Ga0501040_0245874 3300049576 Bacteria 1276
143 Ga0501070_0094661 3300049586 Bacteria 2472
144 Ga0501072_0009918 3300049588 Bacteria 7242
145 Ga0501080_0155026 3300049742 Bacteria 2116
146 nmdc:mga03n38_115527_c1 3300050490 Bacteria 1313
147 nmdc:mga03n38_47355_c1 3300050490 Bacteria 1902
148 nmdc:mga00v17_20306_c1 3300050491 Bacteria 3804
149 nmdc:mga00v17_69763_c1 3300050491 Bacteria 2176
150 nmdc:mga0yw44_11235_c1 3300050492 Bacteria 4612
151 nmdc:mga0yw44_1996_c1 3300050492 Bacteria 8478
152 nmdc:mga04h51_12265_c1 3300050495 Bacteria 2402
153 nmdc:mga05p37_78_c1 3300050507 Bacteria 85760
154 nmdc:mga09592_64148_c1 3300050508 Bacteria 3110
155 nmdc:mga0qj67_21867_c1 3300050509 Bacteria 4907
156 nmdc:mga06r32_35894_c1 3300050510 Bacteria 4679
157 nmdc:mga08y16_264471_c1 3300050511 Bacteria 1776
158 nmdc:mga08y16_29014_c1 3300050511 Bacteria 5832
159 nmdc:mga0sz30_130646_c1 3300050516 Bacteria 1106
160 nmdc:mga0sz30_37437_c1 3300050516 Bacteria 2030
161 Ga0500593_017312 3300053117 Bacteria 3131
162 Ga0501082_0001104 3300060353 Bacteria 23858
163 Ga0501082_0357870 3300060353 Bacteria 1273
164 Ga0501082_0627009 3300060353 Bacteria 941
165 2509129002 2508501125 Bacteria 7208311
166 Ga0496100_0011464
167 Ga0065165_1000048
168 Ga0070658_10022012
169 Ga0070690_100158580
170 Ga0070680_100003611
171 Ga0070660_100022763
172 Ga0070660_100095555
173 Ga0070660_100208398
174 Ga0070660_100368396
175 Ga0070691_10132875
176 Ga0070687_100189361
177 Ga0070692_10022231
178 Ga0070692_10076984
179 Ga0070668_100157056
180 Ga0070673_100389399
181 Ga0070659_100013809
182 Ga0070714_100704345
183 Ga0070708_100368271
184 Ga0070662_100001520
185 Ga0070662_100053415
186 Ga0070706_100048614
187 Ga0070707_100253663
188 Ga0070679_100016046
189 Ga0070697_100073894
190 Ga0070695_100214110
191 Ga0070704_100001202
192 Ga0070704_100137763
193 Ga0068855_100165997
194 Ga0068855_100615754
195 Ga0070664_100023937
196 Ga0068852_100008722
197 Ga0068859_100359109
198 Ga0068861_100005813
199 Ga0068861_100097824
200 Ga0068860_100216913
201 Ga0075365_10001473
202 Ga0075365_10268723
203 Ga0075368_10015158
204 Ga0075363_100047059
205 Ga0075363_100070816
206 Ga0075364_10002806
207 Ga0075364_10014270
208 Ga0075367_10056454
209 Ga0075369_10038948
210 Ga0075428_100013544
211 Ga0075430_100043664
212 Ga0075431_100007748
213 Ga0097620_100359114
214 Ga0105240_10387240
215 Ga0111539_10017271
216 Ga0111539_10114919
217 Ga0105245_10176740
218 Ga0114129_10074906
219 Ga0157373_10004777
220 Ga0157371_10062523
221 Ga0157371_10087682
222 Ga0157370_10046939
223 Ga0157370_10279612
224 Ga0157372_10133830
225 Ga0157380_10001065
226 Ga0157380_10052170
227 Ga0157380_10195187
228 Ga0209130_1000071
229 Ga0209025_1002646
230 Ga0207647_10011163
231 Ga0207705_10056947
232 Ga0207684_10097259
233 Ga0207660_10001359
234 Ga0207660_10172223
235 Ga0207657_10000092
236 Ga0207657_10000834
237 Ga0207657_10011546
238 Ga0207652_10016689
239 Ga0207646_10022451
240 Ga0207664_10177288
241 Ga0207706_10001268
242 Ga0207706_10013337
243 Ga0207691_10366010
244 Ga0207711_10211686
245 Ga0207679_10060173
246 Ga0207679_10186499
247 Ga0207640_10054409
248 Ga0207640_10297152
249 Ga0207708_10025037
250 Ga0207648_10061579
251 Ga0207674_10169767
252 Ga0207674_10261614
253 Ga0207675_100004368
254 Ga0207675_100005583
255 Ga0207675_100229550
256 Ga0207698_10020796
257 Ga0207698_10238101
258 Ga0207698_10471940
259 Ga0209813_10077669
260 Ga0268265_10426827
261 Ga0268264_10058207
262 Ga0268264_10270470
263 Ga0265318_10009681
264 Ga0265332_10000508
265 Ga0265325_10059268
266 Ga0265340_10001840
267 Ga0265339_10054700
268 Ga0265331_10054534
269 Ga0307408_100153782
270 Ga0307408_100285239
271 Ga0265313_10026585
272 Ga0265314_10147127
273 Ga0265314_10204015
274 Ga0265342_10000573
275 Ga0265342_10025400
276 Ga0265342_10048083
277 Ga0307410_10211261
278 Ga0373931_0149245
279 Ga0395899_0000132
280 Ga0395899_0001034
281 Ga0395899_0407363
282 Ga0395900_0001575
283 Ga0395900_0009719
284 Ga0395900_0017948
285 Ga0395900_0265052
286 Ga0395898_0001192
287 Ga0395898_0004405
288 Ga0395898_0150083
289 Ga0395905_0004350
290 Ga0395905_0004978
291 Ga0395905_0125481
292 Ga0395901_0000208
293 Ga0395901_0038269
294 Ga0395901_0077831
295 Ga0395901_0082638
296 Ga0395901_0298382
297 Ga0436365_1934512
298 Ga0436361_0545741
299 Ga0439432_001924
300 Ga0466958_0304919
301 Ga0466967_0006189
302 Ga0466967_0084489
303 Ga0466967_0200033
304 Ga0495582_0023983
305 Ga0495615_0049335
306 Ga0501040_0062096
307 Ga0501040_0245874
308 Ga0501070_0094661
309 Ga0501072_0009918
310 Ga0501080_0155026
311 nmdc:mga03n38_115527_c1
312 nmdc:mga03n38_47355_c1
313 nmdc:mga00v17_20306_c1
314 nmdc:mga00v17_69763_c1
315 nmdc:mga0yw44_11235_c1
316 nmdc:mga0yw44_1996_c1
317 nmdc:mga04h51_12265_c1
318 nmdc:mga05p37_78_c1
319 nmdc:mga09592_64148_c1
320 nmdc:mga0qj67_21867_c1
321 nmdc:mga06r32_35894_c1
322 nmdc:mga08y16_264471_c1
323 nmdc:mga08y16_29014_c1
324 nmdc:mga0sz30_130646_c1
325 nmdc:mga0sz30_37437_c1
326 Ga0500593_017312
327 Ga0501082_0001104
328 Ga0501082_0357870
329 Ga0501082_0627009
330 2509129002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

103

311

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i7o-assembly4.cif.gz_D crystal structure of hpce 0.9345 73 283
6sbi-assembly2.cif.gz_C x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate 0.9268 72 283
1wzo-assembly1.cif.gz_A crystal structure of the hpce from thermus thermophilus hb8 0.9259 1 284
6fog-assembly4.cif.gz_D x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. 0.9251 74 284
1wzo-assembly1.cif.gz_C crystal structure of the hpce from thermus thermophilus hb8 0.924 1 283
ID Description Score Start End Superfamily
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9634 69 282 3.90.850.10
6jvvA02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9554 72 283 3.90.850.10
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.95 69 282 3.90.850.10
af_Q54BF3_56_305_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9451 53 281 3.90.850.10
af_A0A0R4IWE1_56_289_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9434 49 281 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A5M6IY40-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9723 1 287 GO:0016787
GO:0044281
AF-A0A3D1GV77-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.9681 118 284 GO:0016853
GO:0044281
AF-A0A0B6RZZ6-F1-model_v4 Putative ureidoglycolate lyase (EC 4.3.2.3) 0.9665 95 284 GO:0019628
GO:0050385
AF-A0A1L3ZSU8-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9661 77 287 GO:0003824
GO:0046872
AF-A0A524GLR5-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9661 115 281 GO:0018773
GO:0046872

Map